The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.4543: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: Aspartokinase (EC 2.7.2.4)
Translate Function Assignments



Context on contig APYN01000081 from base 15758 to 29067 (13310 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4537 16447 15758 690 -           alpha-aspartyl dipeptidase Peptidase E (EC 3.4.13.21) gene_name|pepE, locus|ECP02999174_4631, protein_id|ENC51961.1, gi|476964165
4538 16659 17531 873 + 211         Ribosomal large subunit pseudouridine synthase F (EC 4.2.1.70) gene_name|rluF, locus|ECP02999174_4632, protein_id|ENC51962.1, gi|476964166
4539 17804 17532 273 - 0         Uncharacterized protein YjbD locus|ECP02999174_4633, protein_id|ENC51963.1, gi|476964167
4540 18334 19461 1128 + 529         Putative stomatin/prohibitin-family membrane protease subunit PA4582 locus|ECP02999174_4634, protein_id|ENC51964.1, gi|476964168
4541 19467 20258 792 + 5         COG3541: Predicted nucleotidyltransferase locus|ECP02999174_4635, protein_id|ENC51965.1, gi|476964169
4542 21220 20294 927 - 35         COG0148: Enolase locus|ECP02999174_4636, protein_id|ENC51966.1, gi|476964170
4543 22714 21365 1350 - 144     3: 1 2 3   Aspartokinase (EC 2.7.2.4) locus|ECP02999174_4637, protein_id|ENC51967.1, gi|476964171
4544 23239 24888 1650 + 524     1: 4   Glucose-6-phosphate isomerase (EC 5.3.1.9) gene_name|pgi, locus|ECP02999174_4638, protein_id|ENC51968.1, gi|476964172
4545 25243 25485 243 + 354         YjbE secreted protein locus|ECP02999174_4639, protein_id|ENC51969.1, gi|476964173
4546 25599 26237 639 + 113         YjbF outer membrane lipoprotein locus|ECP02999174_4640, protein_id|ENC51970.1, gi|476964174
4547 26234 26971 738 + -4         YjbG polysaccharide synthesis-related protein locus|ECP02999174_4641, protein_id|ENC51971.1, gi|476964175
4548 26971 29067 2097 + -1         YjbH outer membrane lipoprotein locus|ECP02999174_4642, protein_id|ENC51972.1, gi|476964176

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Lysine_biosynthesis_PanGenomes Acharya_Geeta_user Aspartokinase (EC 2.7.2.4)
Methionine_biosynthesis_PanGenomes Acharya_Geeta_user Aspartokinase (EC 2.7.2.4)
Threonine_biosynthesis_PanGenomes Acharya_Geeta_user Aspartokinase (EC 2.7.2.4)


  Protein Sequence

>fig|1116050.3.peg.4543 Aspartokinase (EC 2.7.2.4)
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNDGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHFNLFE

MD5 = cad14d71b78df846589e05217664d943


  DNA Sequence

>fig|1116050.3.peg.4543 Aspartokinase (EC 2.7.2.4)
atgtctgaaattgttgtctccaaatttggcggtaccagcgtagctgattttgacgccatg
aaccgcagcgctgatattgtgctttctgatgccaacgtgcgtttagtagtcctctcggct
tctgctggtatcactaatctgctggtcgctttagcggaagggctggaacctggcgagcga
ttcgaaaaactcgacgctattcgcaacatccagtttgccattctggaacgtctgcgttac
ccgaacgttatccgtgaagagattgaacgtctgctggagaacattactgttctggcagaa
gcggcggcgctggcaacgtctccggcgctgacagatgagctggtcagccacggcgagctg
atgtcgaccctgctgtttgtcgaaatcctgcgcgaacgcgatgttcaggcacagtggttt
gatgtacgtaaagtaatgcgtaccaacgaccgatttggtcgtgcagagccagatgtagcc
gcgctggcggaactggccgcgctgcagctgctcccacgcctcaatgacggcttagtgatc
acccagggatttatcggtagcgaaaataaaggtcgtacaacgacgcttggccgtggaggc
agcgattatacggcagccttgctggcggaggctttacacgcatctcgtgttgatatctgg
accgacgtcccgggcatctacaccaccgatccacgcgtagtttccgcagcaaaacgcatt
gatgaaatcgcgtttgccgaagcggcagagatggcaacttttggtgcaaaagtactgcat
ccggcaacgttgctacccgcagtacgcagcgatatcccggtctttgtcggctccagcaaa
gacccacgcgcaggtggtacgctggtgtgcaataaaactgaaaatccgccgctgttccgc
gcgctggcgcttcgtcgcaatcagactctgctcactttgcacagcctgaatatgctgcat
tctcgcggcttcctcgcggaagttttcggcatcctcgcgcggcataatatttcggtagac
ttaatcaccacgtcagaagtgagcgtggcattaacccttgataccaccggttcaacctcc
actggcgatacgttgctgacgcaatctctgctgatggagctttccgcactgtgccgggtg
gaagtagaagaaggtctggcgctggtcgcgttgattggcaatgacctgtcaaaagcctgc
ggcgttggcaaagaggtattcggcgtactggaaccgttcaacattcgcatgatttgttac
ggcgcatccagccataacctgtgcttcctggtgcccggcgaagatgccgagcaggtggtg
cagaagctgcattttaatttgtttgagtaa


  DNA with Flanking Sequence

>fig|1116050.3.peg.4543 Aspartokinase (EC 2.7.2.4)
aattgtgactttggaagattgtagcgccagtcacagaaaaatgtgatggttttagtgccg
ttagcgtaatgttgagtgtaaacccttagcgcagtgaagcatttattagctgaactactg
accgccaggagtggatgaaaaatccgcatgaccccgtcgttgacaaccgccccgctcacc
ctttatttataaatgtactacctgcgctagcgcaggccagaagaggcgcgttgcccaagt
aacggtgttggaggagccagtcctgtgataacacctgagggggtgcatcgccgaggtgat
tgaacggctggccacgttcatcatcggctacaggggctgaatcccctgggttgtcaccag
aagcgttcgcagtcgggcgtttcgcaagtggtggagcacttctgggtgaaaatagtagcg
aagtatcgctctgcgcccacccgtcttccgctcttcccttgtgccaaggctgaaaatgga
tcccctgacacgaggtagttatgtctgaaattgttgtctccaaatttggcggtaccagcg
tagctgattttgacgccatgaaccgcagcgctgatattgtgctttctgatgccaacgtgc
gtttagtagtcctctcggcttctgctggtatcactaatctgctggtcgctttagcggaag
ggctggaacctggcgagcgattcgaaaaactcgacgctattcgcaacatccagtttgcca
ttctggaacgtctgcgttacccgaacgttatccgtgaagagattgaacgtctgctggaga
acattactgttctggcagaagcggcggcgctggcaacgtctccggcgctgacagatgagc
tggtcagccacggcgagctgatgtcgaccctgctgtttgtcgaaatcctgcgcgaacgcg
atgttcaggcacagtggtttgatgtacgtaaagtaatgcgtaccaacgaccgatttggtc
gtgcagagccagatgtagccgcgctggcggaactggccgcgctgcagctgctcccacgcc
tcaatgacggcttagtgatcacccagggatttatcggtagcgaaaataaaggtcgtacaa
cgacgcttggccgtggaggcagcgattatacggcagccttgctggcggaggctttacacg
catctcgtgttgatatctggaccgacgtcccgggcatctacaccaccgatccacgcgtag
tttccgcagcaaaacgcattgatgaaatcgcgtttgccgaagcggcagagatggcaactt
ttggtgcaaaagtactgcatccggcaacgttgctacccgcagtacgcagcgatatcccgg
tctttgtcggctccagcaaagacccacgcgcaggtggtacgctggtgtgcaataaaactg
aaaatccgccgctgttccgcgcgctggcgcttcgtcgcaatcagactctgctcactttgc
acagcctgaatatgctgcattctcgcggcttcctcgcggaagttttcggcatcctcgcgc
ggcataatatttcggtagacttaatcaccacgtcagaagtgagcgtggcattaacccttg
ataccaccggttcaacctccactggcgatacgttgctgacgcaatctctgctgatggagc
tttccgcactgtgccgggtggaagtagaagaaggtctggcgctggtcgcgttgattggca
atgacctgtcaaaagcctgcggcgttggcaaagaggtattcggcgtactggaaccgttca
acattcgcatgatttgttacggcgcatccagccataacctgtgcttcctggtgcccggcg
aagatgccgagcaggtggtgcagaagctgcattttaatttgtttgagtaatatttcccta
ctggcgtataacgctcaccgattgttatacgccatcctcactgaaaacatagattaaata
atatctgaaaagcaaaatcactcctgtagaacagtattataatcaccgagaaatatcatt
taacaggagtgttaatggctactttaatggaaaaagatgcacttttaaacggagccagtc
agtgcatcgcgtttttatcaaatatcattgataattgctcagtttcgtcgcatcaggatt
caggcgatgctctcaagcgattagtcagctatcgcgattatctttattctacccccgctg
aacttgttgattttacacaaggtaagattctccttcagcaggtaagaactcaatatcagc
atgaattcaacaatactacgcattcagaaaataaagcatcttttgattctatttggcagc
gtctgacaaatcatgaagtcacaccgcaacagcatcccattggttttgttttaggtgggc
aacccggagc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search