The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PD138722 score=264


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD138722



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), _quot;Gapped BLAST and PSI-BLAST: a new generation of protein database searchprograms_quot;,  Nucleic Acids Res. 25:3389-3402.Query: unkwown	(58 letters)Database: prodom2010.1 multiple alignments	45,292,438 sequences; 2,147,483,647 total lettersProDom domains producing High-scoring Segment Pairs:  Position  ProDom domain                                      Score E value      1-53  #PD138722                                            264 3e-27>PD138722 (Closest domain: D6I1A5_ECOLX 1-230)Number of domains in family: 43Commentary (automatic):SUBNAME: FULL=PUTATIVE UNCHARACTERIZED YHAC FULL=PREDICTED FULL=CONSERVED PREDICTED ALTNAME: B_apos; ECS4001  Length = 230Score = 264  (106.3 bits), Expect = 3e-27Identities = 52/53 (98%), Positives = 53/53 (100%)
 Query:      1 MSPVSSIGNDISSDLVRRKMNDLPESPIGNNLEALAPGIEKLKQTSIQMVTLV 53               MSPVSSIGNDISSDLVRRKMNDLPESPIGNNLEALAPGIEKLKQTSIQMVTL+ Sbjct:      1 MSPVSSIGNDISSDLVRRKMNDLPESPIGNNLEALAPGIEKLKQTSIQMVTLL 53


FIG search