The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC6C5L4 score=220PD056441 score=138PDB026H5 score=227


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PDB026H5
PDC6C5L4
PD056441



HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), _quot;Gapped BLAST and PSI-BLAST: a new generation of protein database searchprograms_quot;,  Nucleic Acids Res. 25:3389-3402.Query: unkwown	(114 letters)Database: prodom2010.1 multiple alignments	45,292,438 sequences; 2,147,483,647 total lettersProDom domains producing High-scoring Segment Pairs:  Position  ProDom domain                                      Score E value      1-42  #PDC6C5L4                                            220 1e-21     43-70  #PD056441                                            138 8e-10    71-113  #PDB026H5                                            227 1e-22>PDB026H5 (Closest domain: Q0TCY5_ECOL5 71-113)Number of domains in family: 65Commentary (automatic):SUBNAME: ACTIVATOR OPERON FULL=THREONINE DEHYDRATASE DNA-BINDING TRANSCRIPTIONAL FULL=DNA-BINDING TDCR TRANSCRIPTION  Length = 43Score = 227  (92.0 bits), Expect = 1e-22Identities = 43/43 (100%), Positives = 43/43 (100%)
 Query:     71 LENKHLFYQYFKISNTGIDHLEQLINVNFFSSDRTSFCECNRF 113               LENKHLFYQYFKISNTGIDHLEQLINVNFFSSDRTSFCECNRF Sbjct:     71 LENKHLFYQYFKISNTGIDHLEQLINVNFFSSDRTSFCECNRF 113
>PDC6C5L4 (Closest domain: E8Y3B7_ECOKO 5-46)Number of domains in family: 44Commentary (automatic):SUBNAME: ACTIVATOR OPERON FULL=THREONINE DEHYDRATASE DNA-BINDING TRANSCRIPTIONAL FULL=DNA-BINDING TDCR REFERENCE Length = 42Score = 220 (89.4 bits), Expect = 1e-21Identities = 42/42 (100%), Positives = 42/42 (100%)
 Query:      1 MTGITIFYGDNIIRYVVNIKKGLRPYFKQLPDNYQAKFELNL 42               MTGITIFYGDNIIRYVVNIKKGLRPYFKQLPDNYQAKFELNL Sbjct:      5 MTGITIFYGDNIIRYVVNIKKGLRPYFKQLPDNYQAKFELNL 46
>PD056441 (Closest domain: E8Y3B7_ECOKO 47-74)Number of domains in family: 65Commentary (automatic):SUBNAME: ACTIVATOR OPERON FULL=THREONINE DEHYDRATASE DNA-BINDING TRANSCRIPTIONAL FULL=DNA-BINDING TDCR TRANSCRIPTION Length = 28Score = 138 (57.8 bits), Expect = 8e-10Identities = 28/28 (100%), Positives = 28/28 (100%)
 Query:     43 MSKFSNFIINKPFSAINTAARHIFSRYL 70               MSKFSNFIINKPFSAINTAARHIFSRYL Sbjct:     47 MSKFSNFIINKPFSAINTAARHIFSRYL 74


FIG search