The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.3552: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: L-threonine transporter, anaerobically inducible
Translate Function Assignments



Context on contig APYN01000064 from base 117586 to 127892 (10307 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3548 118950 117586 1365 -       1: 1   L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17) locus|ECP02999174_3616, protein_id|ENC53853.1, gi|476966125
3549 119411 119022 390 - 71     1: 3 dlit(9484901) 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10) gene_name|tdcF, locus|ECP02999174_3617, protein_id|ENC53854.1, gi|476966126
3550 121719 119425 2295 - 13         2-ketobutyrate formate-lyase (EC 2.3.1.-) / Pyruvate formate-lyase (EC 2.3.1.54) locus|ECP02999174_3618, protein_id|ENC53855.1, gi|476966127
3551 122961 121753 1209 - 33         Acetate kinase (EC 2.7.2.1) @ Propionate kinase (EC 2.7.2.15) locus|ECP02999174_3619, protein_id|ENC53856.1, gi|476966128
3552 124318 122987 1332 - 25         L-threonine transporter, anaerobically inducible locus|ECP02999174_3620, protein_id|ENC53857.1, gi|476966129
3553 125329 124340 990 - 21     1: 2 dlit(9484901) Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) locus|ECP02999174_3621, protein_id|ENC53858.1, gi|476966130
3554 126366 125428 939 - 98       dlit(9484901) Threonine catabolic operon transcriptional activator TdcA locus|ECP02999174_3622, protein_id|ENC53859.1, gi|476966131
3555 126555 126899 345 + 188         Threonine catabolic operon transcriptional activator TdcR locus|ECP02999174_3623, protein_id|ENC53860.1, gi|476966132
3556 127155 127694 540 + 255         orf, hypothetical protein locus|ECP02999174_3624, protein_id|ENC53861.1, gi|476966133
3557 127716 127892 177 + 21         hypothetical protein locus|ECP02999174_3625, protein_id|ENC53862.1, gi|476966134

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116050.3.peg.3552 L-threonine transporter, anaerobically inducible
MSTSDSIVSSQTKQSSWRKSDTTWTLGLFGTAIGAGVLFFPIRAGFGGLIPILLMLVLAY
PIAFYCHRALARLCLSGSNPSGNITETVEEHFGKTGGVVITFLYFFAICPLLWIYGVTIT
NTFMTFWENQLGFAPLNRGFVALFLLLLMAFVIWFGKDLMVKVMSYLVWPFIASLVLISL
SLIPYWNSAVIDQVDLGSLSLTGHDGILITVWLGISIMVFSFNFSPIVSSFVVSKREEYE
KDFGRDFTERKCSQIISRASMLMVAVVMFFAFSCLFTLSPANMAEAKAQNIPVLSYLANH
FASMTGTKTTFAITLEYAASIIALVAIFKSFFGHYLGTLEGLNGLILKFGYKGDKTKVSL
GKLNTISMIFIMGSTWVVAYANPNILDLIEAMGAPIIASLLCLLPMYAIRKAPSLAKYRG
RLDNVFVTVIGLLTILNIVYKLF

MD5 = e45a6199eb9ec98b0ea0d64bdf3b9719


  DNA Sequence

>fig|1116050.3.peg.3552 L-threonine transporter, anaerobically inducible
atgagtacttcagatagcattgtatccagccagacaaaacaatcgtcctggcgtaaatca
gataccacatggacgttaggcttgtttggtacggcaatcggcgccggggtgctgttcttc
cctatccgcgcaggttttggcggactgatcccgattcttctgatgttggtattggcatac
cccatcgcattttattgccaccgggcgctggcgcgtctgtgtctttctggctctaaccct
tccggcaacattacggaaacggtggaagagcattttggtaaaactggcggcgtggttatc
acgttcctgtacttcttcgcgatttgcccactgctgtggatttatggcgttactattacc
aatacctttatgacgttctgggaaaaccagctcggatttgcaccgctgaatcgcggcttt
gtggcgctgttcctgttgctgctgatggctttcgtcatctggtttggtaaggatctgatg
gttaaagtgatgagctacctggtatggccgtttatcgccagcctggtgctgatttctctg
tcgctgatcccttactggaactctgcagttatcgaccaggttgacctcggttcgctgtcg
ttaaccggtcatgacggtatcctgatcactgtctggctggggatttccatcatggttttc
tcctttaacttctcgccaatcgtctcttccttcgtggtttctaaacgtgaagagtatgag
aaagacttcggtcgcgacttcaccgaacgtaaatgttcccaaatcatttctcgtgccagc
atgctgatggttgcagtggtgatgttctttgcctttagctgcctgtttacgctgtctccg
gccaacatggcggaagccaaagcgcagaatattccagtgctttcttatctggctaaccac
tttgcgtccatgaccggtaccaaaacaacgttcgcgattacactggaatatgcggcttcc
atcatcgcactcgtggctatcttcaaatctttcttcggtcactatctggggacgctggaa
ggcttgaatggtctgattctgaagttcggttataaaggcgacaaaactaaagtgtcgctg
ggtaaactgaacactatcagcatgatcttcatcatgggctccacctgggttgttgcctac
gccaacccgaacatcctcgaccttattgaagccatgggcgcaccgattatcgcatccctg
ctgtgcctgttgccgatgtatgccatccgtaaagcgccgtctctggcgaaataccgtggt
cgtctggataacgtgtttgttaccgtgattggtctgctgaccatcctgaacatcgtatac
aaactgttttaa


  DNA with Flanking Sequence

>fig|1116050.3.peg.3552 L-threonine transporter, anaerobically inducible
aagatctctatgatgtcgataacgtgattgtgccaattggtggtggtggtttaattgctg
gtattgcggtggcaattaaatctattaacccgaccattcgtgttattggcgtacagtcag
aaaacgttcacggcatggcggcttctttccactccggagaaataaccacgcaccgaacta
ccggcaccctggcggatggttgtgatgtctcccgcccgggtaatttaacttacgaaatcg
ttcgtgaattagtcgatgacatcgtgctggtcagcgaagacgaaatcagaaacagtatga
ttgccttaattcagcgcaataaagtcgtcaccgaaggcgcaggcgctctggcatgtgctg
cattattaagcggtaaattagaccaatatattcaaaacagaaaaaccgtcagtattattt
ccggcggcaatatcgatctttctcgcgtctctcaaatcaccggtttcgttgacgcttaat
taattcgttgaggataggatatgagtacttcagatagcattgtatccagccagacaaaac
aatcgtcctggcgtaaatcagataccacatggacgttaggcttgtttggtacggcaatcg
gcgccggggtgctgttcttccctatccgcgcaggttttggcggactgatcccgattcttc
tgatgttggtattggcataccccatcgcattttattgccaccgggcgctggcgcgtctgt
gtctttctggctctaacccttccggcaacattacggaaacggtggaagagcattttggta
aaactggcggcgtggttatcacgttcctgtacttcttcgcgatttgcccactgctgtgga
tttatggcgttactattaccaatacctttatgacgttctgggaaaaccagctcggatttg
caccgctgaatcgcggctttgtggcgctgttcctgttgctgctgatggctttcgtcatct
ggtttggtaaggatctgatggttaaagtgatgagctacctggtatggccgtttatcgcca
gcctggtgctgatttctctgtcgctgatcccttactggaactctgcagttatcgaccagg
ttgacctcggttcgctgtcgttaaccggtcatgacggtatcctgatcactgtctggctgg
ggatttccatcatggttttctcctttaacttctcgccaatcgtctcttccttcgtggttt
ctaaacgtgaagagtatgagaaagacttcggtcgcgacttcaccgaacgtaaatgttccc
aaatcatttctcgtgccagcatgctgatggttgcagtggtgatgttctttgcctttagct
gcctgtttacgctgtctccggccaacatggcggaagccaaagcgcagaatattccagtgc
tttcttatctggctaaccactttgcgtccatgaccggtaccaaaacaacgttcgcgatta
cactggaatatgcggcttccatcatcgcactcgtggctatcttcaaatctttcttcggtc
actatctggggacgctggaaggcttgaatggtctgattctgaagttcggttataaaggcg
acaaaactaaagtgtcgctgggtaaactgaacactatcagcatgatcttcatcatgggct
ccacctgggttgttgcctacgccaacccgaacatcctcgaccttattgaagccatgggcg
caccgattatcgcatccctgctgtgcctgttgccgatgtatgccatccgtaaagcgccgt
ctctggcgaaataccgtggtcgtctggataacgtgtttgttaccgtgattggtctgctga
ccatcctgaacatcgtatacaaactgttttaatccgtaactcaggatgagaaaagagatg
aatgaatttccggttgttttggttattaactgtggttcgtcttcgattaagttttccgta
ctcgatgccagcgactgtgaagtattaatgtcaggtattgccgacggtattaactcggaa
aatgcattcttatccgtaaatgggggagagccagcaccgctggctcaccacagctacgaa
ggtgcattgaaggcaattgcatttgaactggaaaaacggaatttaaatgacagtgtggcc
ttaattggccaccgcatcgctcacggcggcagtatttttaccgagtccgccattattacc
gatgaagtcattgataatatccgtcgcgtttctccactggcacccctgcataattacgcc
aatttaagtggtattgaatcggcgcagcaattatttccgggcgtaactcaggtggcggta
tttgataccagtttccaccagacgatggctccggaagcttatttatacggcc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search