The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDA9Z7W1 score=179PDC654Q5 score=134PDB074R4 score=217PD911289 score=327


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD911289
PDB074R4
PDA103Q0
PDB0N7O8
PDA9Z7W1
PDB086A0
PDB08080
PDC656L7
PDB33466
PD002429
PDB0G491
PDB076F8
PDB01016
PDC654Q5
PDB3K8J9
PDB0L1J2
PDB031D3
PD611719
PDC02867
PDC641R3
PDC8J4Q4
PD457409
PDB1I2Y0
PDB1E8N1
PD912238
PDC639F8
PDC8K5V4
PDC3T2C7
PDB617R6
PDD4G4G1
PDB0C0I3
PDC6Z946
PDB6N8J7
PD912239
PDB3W188
PDC9M0A1
PDB0Y3E9

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD911289
PDB074R4
PDA103Q0
PDB0N7O8
PDA9Z7W1
PDB086A0
PDC656L7
PDB33466
PD002429
PDB01016
PDC654Q5
PDB3K8J9
PDB031D3
PD611719
PDC641R3
PDC639F8
PDB0C0I3
PD912239

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD911289
PDB074R4
PDA103Q0
PDB0N7O8
PDA9Z7W1
PDB086A0
PDC656L7
PDB33466
PD002429
PDB01016
PDC654Q5
PDB3K8J9
PDB031D3
PD611719
PDC641R3
PDC639F8
PDB0C0I3
PD912239


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), _quot;Gapped BLAST and PSI-BLAST: a new generation of protein database searchprograms_quot;,  Nucleic Acids Res. 25:3389-3402.Query: unkwown	(129 letters)Database: prodom2010.1 multiple alignments	45,292,438 sequences; 2,147,483,647 total lettersProDom domains producing High-scoring Segment Pairs:  Position  ProDom domain                                      Score E value      1-35  #PDA9Z7W1                                            179 1e-15      1-21  #PDC641R3                                            107 2e-05      3-37  #PDB0C0I3                                            100 0.0002      9-75  #PDB0L1J2                                            127 8e-08     10-42  #PDC8J4Q4                                            106 3e-05     10-98  #PD912238                                            103 0.0003     17-65  #PD912239                                             96 0.001     24-81  #PDC8K5V4                                            101 0.0002     24-93  #PDC3T2C7                                            101 0.001     24-77  #PDB6N8J7                                             97 0.0007     26-96  #PDD4G4G1                                            100 0.002     34-78  #PDB1E8N1                                            104 6e-05     36-61  #PDC654Q5                                            134 5e-09     37-80  #PDB074R4                                            217 4e-21     38-75  #PDB0N7O8                                            186 2e-16     40-70  #PD002429                                            150 3e-11     45-82  #PDC02867                                            120 4e-07     45-85  #PDB33466                                            155 6e-12     45-81  #PDB0Y3E9                                             89 0.007    46-116  #PDB617R6                                            101 0.0002     46-85  #PDA103Q0                                            196 5e-18     46-90  #PDB3W188                                             96 0.001     48-96  #PDC656L7                                            159 2e-12     49-90  #PDC6Z946                                             97 0.0006    49-124  #PD457409                                            106 5e-05    54-116  #PDB0G491                                            147 9e-11    54-124  #PDB08080                                            160 2e-12    65-126  #PD911289                                            327 2e-37    69-114  #PDC9M0A1                                             95 0.002     72-91  #PDC639F8                                            101 0.0002    76-125  #PDB1I2Y0                                            106 4e-05    78-125  #PDB076F8                                            137 2e-09    79-125  #PDB01016                                            135 4e-09    82-125  #PD611719                                            126 7e-08    87-126  #PDB031D3                                            126 5e-08    87-126  #PDB086A0                                            164 3e-13    94-122  #PDB3K8J9                                            128 3e-08>PD911289 (Closest domain: Q1R6M0_ECOUT 86-147)Number of domains in family: 873Commentary (automatic):SUBNAME: FULL=PUTATIVE L-PSP FULL=ENDORIBONUCLEASE UNCHARACTERIZED ENDORIBONUCLEASE INHIBITOR INITIATION TRANSLATION FAMILY  Length = 62Score = 327  (130.6 bits), Expect = 2e-37Identities = 62/62 (100%), Positives = 62/62 (100%)
 Query:     65 GLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAI 124               GLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAI Sbjct:     86 GLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAI 145 Query:    125 AV 126               AV Sbjct:    146 AV 147
>PDB074R4 (Closest domain: G0DCR9_ECOLX 37-80)Number of domains in family: 205Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED ENDORIBONUCLEASE INITIATION INHIBITOR PLASMID REFERENCE Length = 44Score = 217 (88.2 bits), Expect = 4e-21Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 1/44 (2%)
 Query:     37 PQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80               PQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD Sbjct:     37 PQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80
>PDA103Q0 (Closest domain: F4W009_ECOLX 46-85)Number of domains in family: 677Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED ENDORIBONUCLEASE INHIBITOR INITIATION FAMILY PLASMID Length = 40Score = 196 (80.1 bits), Expect = 5e-18Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 1/40 (2%)
 Query:     46 VQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFA 85               VQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFA Sbjct:     46 VQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFA 85
>PDB0N7O8 (Closest domain: TDCF_SHIFL 38-75)Number of domains in family: 258Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED INITIATION ENDORIBONUCLEASE INHIBITOR FAMILY L-PSP Length = 38Score = 186 (76.3 bits), Expect = 2e-16Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 1/38 (2%)
 Query:     38 QTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMT 75               QTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMT Sbjct:     38 QTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMT 75
>PDA9Z7W1 (Closest domain: F4W009_ECOLX 1-35)Number of domains in family: 813Commentary (automatic):SUBNAME: L-PSP FULL=PUTATIVE FULL=ENDORIBONUCLEASE UNCHARACTERIZED ENDORIBONUCLEASE INHIBITOR INITIATION FAMILY TRANSLATION Length = 35Score = 179 (73.6 bits), Expect = 1e-15Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 3/35 (8%)
 Query:      1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPV 35               MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPV Sbjct:      1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPV 35
>PDB086A0 (Closest domain: Q0T9E5_ECOL5 87-126)Number of domains in family: 217Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED ENDORIBONUCLEASE INITIATION INHIBITOR REFERENCE FAMILY Length = 40Score = 164 (67.8 bits), Expect = 3e-13Identities = 29/40 (72%), Positives = 34/40 (85%), Gaps = 3/40 (7%)
 Query:     87 INEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAV 126               +N  Y+ FF EH AT+P RSCV+VARLPKDVK+EIEAIAV Sbjct:     87 VNATYEAFFTEHNATFPARSCVEVARLPKDVKIEIEAIAV 126
>PDB08080 (Closest domain: D5BFV4_ZUNPS 55-124)Number of domains in family: 49Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP FULL=PUTATIVE UNCHARACTERIZED INHIBITOR INITIATION PRECURSOR REFERENCE FAMILY Length = 70Score = 160 (66.2 bits), Expect = 2e-12Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (2%)
 Query:     54 LENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARL 113               +EN+KAI+  A  +  ++IK ++FI+D+N+F  INE+Y  +F     T P R  V+VA L Sbjct:     56 MENLKAILAEANCTFENVIKTSIFISDMNNFGKINEIYGTYF--RADTAPARETVEVANL 113 Query:    114 PKDVKLEIEAI 124               PK V +EI AI Sbjct:    114 PKFVNVEISAI 124
>PDC656L7 (Closest domain: G7VV41_PAETH 48-96)Number of domains in family: 139Commentary (automatic):SUBNAME: L-PSP FULL=PUTATIVE FULL=ENDORIBONUCLEASE INHIBITOR UNCHARACTERIZED ENDORIBONUCLEASE INITIATION OXIDOREDUCTASE REDUCTASE Length = 49Score = 159 (65.9 bits), Expect = 2e-12Identities = 28/49 (57%), Positives = 39/49 (79%), Gaps = 3/49 (6%)
 Query:     48 DQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFD 96               +QARLSL NV+AI+ AAG S+  ++K TVF+ D+NDF ++NEVY  FF+ Sbjct:     48 EQARLSLSNVQAILEAAGSSLNQVVKATVFLKDMNDFVSVNEVYSSFFE 96
>PDB33466 (Closest domain: B5F444_SALA4 44-85)Number of domains in family: 194Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED INITIATION INHIBITOR ENDORIBONUCLEASE FULL=TRANSLATION FAMILY Length = 42Score = 155 (64.3 bits), Expect = 6e-12Identities = 32/41 (78%), Positives = 34/41 (82%), Gaps = 3/41 (7%)
 Query:     45 DVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFA 85               DV  QAR SLENVKAIV AAGL VGDI+K TVF+ DLNDFA Sbjct:     45 DVSAQARQSLENVKAIVEAAGLKVGDIVKTTVFVKDLNDFA 85
>PD002429 (Closest domain: H0QED8_ECOLI 40-70)Number of domains in family: 1150Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED ENDORIBONUCLEASE INITIATION INHIBITOR FAMILY TRANSLATION Length = 31Score = 150 (62.4 bits), Expect = 3e-11Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 3/31 (9%)
 Query:     40 GEIPADVQDQARLSLENVKAIVVAAGLSVGD 70               GEIPADVQDQARLSLENVKAIVVAAGLSVGD Sbjct:     40 GEIPADVQDQARLSLENVKAIVVAAGLSVGD 70
>PDB0G491 (Closest domain: A6WI81_SHEB8 52-117)Number of domains in family: 68Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE PRECURSOR FLAGS: SIGNAL ENDORIBONUCLEASE FAMILY FULL=L-PSP Length = 66Score = 147 (61.2 bits), Expect = 9e-11Identities = 26/63 (41%), Positives = 42/63 (66%), Gaps = 3/63 (4%)
 Query:     54 LENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARL 113                EN+ A+  AAG S+ DI+K+ +F+ DL+ FA +NE+  ++F +    YP R+ + V +L Sbjct:     57 FENLTAVCTAAGGSINDIVKLNIFLIDLSHFAKVNEIMSRYFSQ---PYPARAAIGVKQL 113 Query:    114 PKD 116               PKD Sbjct:    114 PKD 116
>PDB076F8 (Closest domain: Q2JNV5_SYNJB 76-123)Number of domains in family: 153Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE INITIATION INHIBITOR ENDORIBONUCLEASE PLASMID FAMILY UNCHARACTERIZED Length = 48Score = 137 (57.4 bits), Expect = 2e-09Identities = 26/48 (54%), Positives = 35/48 (72%), Gaps = 2/48 (4%)
 Query:     78 ITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIA 125               + D+ DFA +NEVY++FF    A  P RSCVQVARLP + ++EIE +A Sbjct:     76 LADMEDFAAMNEVYREFFATDPA--PARSCVQVARLPLNARVEIEVVA 121
>PDB01016 (Closest domain: A7S2C7_NEMVE 84-127)Number of domains in family: 105Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP FULL=PUTATIVE DOMAIN-CONTAINING INHIBITOR INITIATION UNCHARACTERIZED REFERENCE ENDORIBONUCLEASE Length = 44Score = 135 (56.6 bits), Expect = 4e-09Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Query:     79 TDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIA 125                D+NDFA +NEVYK +F E Q   P R+  Q A LPK  ++EIEAIA Sbjct:     84 ADINDFAAVNEVYKSYFTEKQ---PARAAYQAANLPKGARVEIEAIA 127
>PDC654Q5 (Closest domain: F4TXM0_ECOLX 36-61)Number of domains in family: 149Commentary (automatic):SUBNAME: FULL=PUTATIVE L-PSP ENDORIBONUCLEASE UNCHARACTERIZED FULL=ENDORIBONUCLEASE FULL=KETOACID-BINDING YJGF MRNA FULL=PREDICTED Length = 26Score = 134 (56.2 bits), Expect = 5e-09Identities = 26/26 (100%), Positives = 26/26 (100%), Gaps = 3/26 (11%)
 Query:     36 CPQTGEIPADVQDQARLSLENVKAIV 61               CPQTGEIPADVQDQARLSLENVKAIV Sbjct:     36 CPQTGEIPADVQDQARLSLENVKAIV 61
>PDB3K8J9 (Closest domain: RIDA_ECOLI 94-122)Number of domains in family: 560Commentary (automatic):SUBNAME: L-PSP FULL=PUTATIVE FULL=ENDORIBONUCLEASE ENDORIBONUCLEASE UNCHARACTERIZED INITIATION INHIBITOR REFERENCE FAMILY Length = 29Score = 128 (53.9 bits), Expect = 3e-08Identities = 23/29 (79%), Positives = 26/29 (89%), Gaps = 1/29 (3%)
 Query:     94 FFDEHQATYPTRSCVQVARLPKDVKLEIE 122               FF EH AT+P RSCV+VARLPKDVK+EIE Sbjct:     94 FFTEHNATFPARSCVEVARLPKDVKIEIE 122
>PDB0L1J2 (Closest domain: C7UMQ3_ENTFA 7-76)Number of domains in family: 87Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED FAMILY PLASMID INHIBITOR ENDORIBONUCLEASE REFERENCE Length = 70Score = 127 (53.5 bits), Expect = 8e-08Identities = 24/67 (35%), Positives = 44/67 (65%), Gaps = 3/67 (4%)
 Query:      9 RAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSV 68               +AP A+GPY   V  G+ ++ SGQ+ + PQ+GE+ A V++QA+ +  N+ +I+    ++  Sbjct:     10 QAPAAVGPYSHSVLAGNTLYISGQLGLDPQSGEMKATVEEQAKQAFINLGSILKEVEMTY 69 Query:     69 GDIIKMT 75                +I+K T Sbjct:     70 DNIVKTT 76
>PDB031D3 (Closest domain: G8LTV2_CLOCD 89-126)Number of domains in family: 733Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED ENDORIBONUCLEASE FAMILY INITIATION INHIBITOR REFERENCE Length = 38Score = 126 (53.1 bits), Expect = 5e-08Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 3/40 (7%)
 Query:     87 INEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAV 126               +N++Y Q+F E    YP RSCV+VARLPKDV +EIEA+A+ Sbjct:     89 VNKIYGQYFKE---PYPARSCVEVARLPKDVLVEIEAVAI 125
>PD611719 (Closest domain: UK114_HUMAN 87-127)Number of domains in family: 41Commentary (automatic):SUBNAME: FULL=PUTATIVE REFERENCE UNCHARACTERIZED UP-REGULATED FULL=MEIOTICALLY GENE UK114 FULL=RIBONUCLEASE L-PSP Length = 41Score = 126 (53.1 bits), Expect = 7e-08Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 3/44 (6%)
 Query:     82 NDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIA 125               NDF T+NE+YKQ+F   ++ +P R+  QVA LPK  ++EIEA+A Sbjct:     87 NDFNTVNEIYKQYF---KSNFPARAAYQVAALPKGSRIEIEAVA 127
>PDC02867 (Closest domain: D3VIP7_XENNA 60-97)Number of domains in family: 71Commentary (automatic):SUBNAME: L-PSP FULL=PUTATIVE FULL=ENDORIBONUCLEASE UNCHARACTERIZED INHIBITOR TRANSLATION INITIATION FAMILY PLASMID Length = 38Score = 120 (50.8 bits), Expect = 4e-07Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 3/38 (7%)
 Query:     45 DVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLN 82               D+  QAR SLENVKAI+  +GL V DI+K TVF+ DLN Sbjct:     60 DITAQARQSLENVKAIIEQSGLKVSDIVKTTVFVKDLN 97
>PDC641R3 (Closest domain: H0QED8_ECOLI 1-21)Number of domains in family: 323Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED ENDORIBONUCLEASE INHIBITOR INITIATION L-PSP REFERENCE Length = 21Score = 107 (45.8 bits), Expect = 2e-05Identities = 21/21 (100%), Positives = 21/21 (100%), Gaps = 3/21 (14%)
 Query:      1 MKKIIETQRAPGAIGPYVQGV 21               MKKIIETQRAPGAIGPYVQGV Sbjct:      1 MKKIIETQRAPGAIGPYVQGV 21
>PDC8J4Q4 (Closest domain: D3F5U6_CONWI 12-50)Number of domains in family: 4Commentary (automatic):SUBNAME: FULL=PUTATIVE UNCHARACTERIZED ENDORIBONUCLEASE PRECURSOR FULL=ENDORIBONUCLEASE REFERENCE FAMILY FLAGS: SIGNAL Length = 39Score = 106 (45.4 bits), Expect = 3e-05Identities = 20/33 (60%), Positives = 24/33 (72%), Gaps = 3/33 (9%)
 Query:     10 APGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEI 42               AP AIGPYV  V    M++ SGQIP+ P+TGEI Sbjct:     13 APAAIGPYVHAVSAKGMLYCSGQIPLHPETGEI 45
>PD457409 (Closest domain: C9QE89_VIBOR 338-411)Number of domains in family: 38Commentary (automatic):SUBNAME: INITIATION INHIBITOR FULL=PUTATIVE FULL=TRANSLATION UNCHARACTERIZED L-PSP FULL=ENDORIBONUCLEASE TRANSLATION DOMAIN Length = 74Score = 106 (45.4 bits), Expect = 5e-05Identities = 21/76 (27%), Positives = 45/76 (59%), Gaps = 3/76 (3%)
 Query:     49 QARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCV 108               QA+  L ++K+IV + G  + D++K+ + +T++ D   ++EVY  FF+      P R+ + Sbjct:    338 QAKQCLTHIKSIVESIGHEMDDLVKVNIQLTNMADLHMVDEVYTTFFN---GNLPARTVI 394 Query:    109 QVARLPKDVKLEIEAI 124                V ++     ++I+A+ Sbjct:    395 GVEKVASGALIQIDAV 410
>PDB1I2Y0 (Closest domain: Q2FNZ3_METHJ 78-124)Number of domains in family: 40Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP FULL=PUTATIVE UNCHARACTERIZED PLASMID REFERENCE INHIBITOR INITIATION FAMILY Length = 47Score = 106 (45.4 bits), Expect = 4e-05Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 3/50 (6%)
 Query:     76 VFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIA 125               +++T+++DF T+N +Y  +        P+RS V VA LPK   +EIE IA Sbjct:     78 IYLTNISDFPTVNAIYSGYMGNET---PSRSTVGVASLPKGALVEIEMIA 124
>PDB1E8N1 (Closest domain: C7ZDW0_NECH7 35-80)Number of domains in family: 106Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED FAMILY INITIATION ENDORIBONUCLEASE PRECURSOR FLAGS: Length = 46Score = 104 (44.7 bits), Expect = 6e-05Identities = 19/45 (42%), Positives = 30/45 (66%), Gaps = 3/45 (6%)
 Query:     34 PVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFI 78               P   + G +PAD + Q  L+L N++ +++AAG S+ DI K+ VFI Sbjct:     35 PGNTKDGHVPADYESQIHLALLNLRKLIIAAGASIKDIAKLNVFI 79
>PD912238 (Closest domain: D5EFT3_AMICL 131-269)Number of domains in family: 17Commentary (automatic):SUBNAME: FULL=PUTATIVE L-PSP FULL=ENDORIBONUCLEASE UNCHARACTERIZED PLASMID ENDORIBONUCLEASE FAMILY TRANSLATION EXPORTED Length = 139Score = 103 (44.3 bits), Expect = 0.0003Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 17/105 (16%)
 Query:     10 APGAIGPYVQGVDLGSMVFTSGQIP---------VCPQTGEIPADVQDQARLSLE----- 55               AP + G Y   V  G  +F +G +          + P+   +P  +    ++ LE      Sbjct:    161 APASSG-YAPAVRAGDFIFVAGMMATSGKGRNECIPPEARPVPGYLWRGKQIKLETEYII 219 Query:     56 --NVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEH 98                  ++  + A+G S+G+I+K  V++ D+ DF    EV+ ++F E+ Sbjct:    220 KHRLEPALRASGSSLGNIVKAQVYMRDIEDFPAFREVWNKYFPEN 264
>PDC639F8 (Closest domain: TDCF_ECOL6 72-91)Number of domains in family: 432Commentary (automatic):SUBNAME: L-PSP FULL=ENDORIBONUCLEASE FULL=PUTATIVE UNCHARACTERIZED ENDORIBONUCLEASE INHIBITOR INITIATION REFERENCE L-PSP Length = 20Score = 101 (43.5 bits), Expect = 0.0002Identities = 20/20 (100%), Positives = 20/20 (100%), Gaps = 4/20 (20%)
 Query:     72 IKMTVFITDLNDFATINEVY 91               IKMTVFITDLNDFATINEVY Sbjct:     72 IKMTVFITDLNDFATINEVY 91
>PDC8K5V4 (Closest domain: E3HPG6_ACHXA 20-80)Number of domains in family: 4Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP INHIBITOR TRANSLATIONAL OLIGOPEPTIDASE FAMILY FULL=PUTATIVE PROLYL FULL=SIMILAR Length = 61Score = 101 (43.5 bits), Expect = 0.0002Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Query:     24 GSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDL 81               G  +F SGQIP+      +  D+  Q   ++E +K  +  AG ++ D++++TV++TDL Sbjct:     22 GGFLFLSGQIPMDANGQVVRGDITVQTHAAIERIKETLALAGATLKDVVRVTVWLTDL 79
>PDC3T2C7 (Closest domain: Q133S8_RHOPS 1-184)Number of domains in family: 1Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP Length = 184Score = 101 (43.5 bits), Expect = 0.001Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Query:     24 GSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLND 83               G ++F SG IP      ++P D + Q    + N+  ++  AG S+ D++K+ V +T   D Sbjct:     24 GDLLFISG-IPGYDDNRQLPDDFEAQFGFVVVNITRVLTEAGASLRDLVKLNVLLTRAAD 82 Query:     84 FATINEVYKQ 93                A +N++Y Q Sbjct:     83 VAPMNKLYAQ 92
>PDB617R6 (Closest domain: D1AJR5_SEBTE 333-405)Number of domains in family: 110Commentary (automatic):OXIDOREDUCTASE FULL=PUTATIVE REDUCTASE AMINOACRYLATE PERACID RUTC EC=1.-.-.- RECNAME: SUBNAME: REFERENCE Length = 73Score = 101 (43.5 bits), Expect = 0.0002Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Query:     46 VQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTR 105               +++Q    L+N+KAIV +    + D +K+ +F+ ++ D   +NE+Y +F+       P R Sbjct:    336 IKEQTEQCLKNIKAIVESVDHVLEDTVKINIFLKNIEDIEAVNEIYAKFYPNGT---PAR 392 Query:    106 SCVQVARLPKD 116                 V V+ L K+ Sbjct:    393 RIVGVSALQKN 403
>PDD4G4G1 (Closest domain: C1EA01_MICSR 1-189)Number of domains in family: 1Commentary (automatic):SUBNAME: FULL=PREDICTED Length = 189Score = 100 (43.1 bits), Expect = 0.002Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 4/74 (5%)
 Query:     26 MVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFI---TDLN 82               MVF SGQ+ V P  G+   D   QA   L+NVKA++ A+G+ V +I+++  ++   + L  Sbjct:    111 MVFVSGQLGVRPD-GKCATDAYAQAVQCLKNVKAVLHASGMGVENIVRLNAYVKHDSHLK 169 Query:     83 DFATINEVYKQFFD 96               D+    + + +  D Sbjct:    170 DYMRARDEWLEGAD 183
>PDB0C0I3 (Closest domain: Q8ZU06_PYRAE 3-37)Number of domains in family: 88Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP DEAMINASE FULL=PUTATIVE FULL=2-AMINOMUCONATE FAMILY UNCHARACTERIZED ENDORIBONUCLEASE FULL=L-PSP Length = 35Score = 100 (43.1 bits), Expect = 0.0002Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 3/35 (8%)
 Query:      3 KIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCP 37               ++I T +AP  IGPY Q V +G+++F SGQIPV P Sbjct:      3 EVIYTDKAPKPIGPYSQAVRVGNLLFVSGQIPVDP 37
>PDC6Z946 (Closest domain: Q46PT8_CUPPJ 60-101)Number of domains in family: 14Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP DEAMINASE FULL=2-AMINOMUCONATE HYDROLASE EC=3.5.99.5 FULL=PUTATIVE PLASMID 2-AMINOMUCONATE Length = 42Score = 97 (42.0 bits), Expect = 0.0006Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Query:     49 QARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEV 90               Q R  +EN++ I+V AG ++ D+++  VF+ ++NDF   NEV Sbjct:     60 QTRAVIENIRDILVNAGATLADLVETQVFLVNMNDFGGFNEV 101
>PDB6N8J7 (Closest domain: B2I8C6_XYLF2 49-103)Number of domains in family: 3Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP FULL=PUTATIVE UNCHARACTERIZED Length = 55Score = 97 (42.0 bits), Expect = 0.0007Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Query:     24 GSMVFTSGQIPVCPQTGEIPA-DVQDQARLSLENVKAIVVAAGLSVGDIIKMTVF 77               G+ V+ SGQIP+ P TG I A D+  QAR + +N++A+   A  S+  I+++ ++ Sbjct:     49 GNTVYFSGQIPLDPATGTIVAGDLAVQARRAFDNLRAVAETANGSLSKIVRLGLY 103
>PD912239 (Closest domain: C7ZH59_NECH7 19-74)Number of domains in family: 39Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP FAMILY ENDORIBONUCLEASE REFERENCE FULL=PUTATIVE FULL=L-PSP BRT1 UNCHARACTERIZED Length = 56Score = 96 (41.6 bits), Expect = 0.001Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Query:     17 YVQGVDLGSMVFTSGQIPVCPQTGE-IPADVQDQARLSLENVKAIVVAAG 65               + Q V    MV+ SG I + P+T E +   V D+AR++L+N++A++ AAG Sbjct:     19 FSQAVKFNGMVYCSGTIGIDPETDELVSGTVTDRARMALKNLQAVLEAAG 68
>PDB3W188 (Closest domain: F5ZJE5_STRPW 332-379)Number of domains in family: 17Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP FULL=PUTATIVE UNCHARACTERIZED REFERENCE INITIATION FAMILY TRANSLATION INHIBITOR Length = 48Score = 96 (41.6 bits), Expect = 0.001Identities = 16/45 (35%), Positives = 33/45 (73%), Gaps = 3/45 (6%)
 Query:     46 VQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEV 90               V++QA+L+ E+++AI+ +    + D++K+ V++TDLN+   + EV Sbjct:    335 VKEQAQLAFEHIQAIIESVDHVMADVVKINVYMTDLNEMTAVEEV 379
>PDC9M0A1 (Closest domain: E4XA61_OIKDI 315-372)Number of domains in family: 3Commentary (automatic):SUBNAME: SCAFFOLD FULL=PUTATIVE UNCHARACTERIZED SHOTGUN ASSEMBLY SCAFFOLD_17 REFERENCE GENOME SET Length = 58Score = 95 (41.2 bits), Expect = 0.002Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 2/46 (4%)
 Query:     69 GDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLP 114                DI+++ +F+ DL+ F T+N  Y +FF    +T PTR CV+ A LP Sbjct:    315 ADIVQVQLFLRDLSQFNTMNAAYSEFFKGEPST-PTRLCVE-ANLP 358
>PDB0Y3E9 (Closest domain: A9FQI1_SORC5 46-85)Number of domains in family: 56Commentary (automatic):SUBNAME: FULL=ENDORIBONUCLEASE L-PSP FULL=PUTATIVE FAMILY ENDORIBONUCLEASE INITIATION UNCHARACTERIZED TRANSLATION YJGF Length = 40Score = 89 (38.9 bits), Expect = 0.007Identities = 19/37 (51%), Positives = 27/37 (72%), Gaps = 4/37 (10%)
 Query:     45 DVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDL 81               D+ +Q   +L+NV AIV AAG   GD+ +MTV++TDL Sbjct:     49 DLAEQFAQALDNVLAIVAAAGGEPGDVARMTVYVTDL 85


FIG search