The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.3549: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10)
Translate Function Assignments



Context on contig APYN01000064 from base 113641 to 125329 (11689 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3543 113641 114243 603 +           Pirin-like protein YhaK gene_name|yhaK, locus|ECP02999174_3612, protein_id|ENC53849.1, gi|476966121
3544 114263 114430 168 + 19         Uncharacterized protein YhaL locus|ECP02999174_3613, protein_id|ENC53850.1, gi|476966122
3545 114566 114420 147 - -11         FIG00643765: hypothetical protein  
3546 115952 114642 1311 - 75     2: 3 2   L-Cysteine Desulfidase locus|ECP02999174_3614, protein_id|ENC53851.1, gi|476966123
3547 117311 115980 1332 - 27         D-serine uptake protein YhaO gene_name|yhaO, locus|ECP02999174_3615, protein_id|ENC53852.1, gi|476966124
3548 118950 117586 1365 - 274     1: 5   L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17) locus|ECP02999174_3616, protein_id|ENC53853.1, gi|476966125
3549 119411 119022 390 - 71     1: 4 dlit(9484901) 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10) gene_name|tdcF, locus|ECP02999174_3617, protein_id|ENC53854.1, gi|476966126
3550 121719 119425 2295 - 13         2-ketobutyrate formate-lyase (EC 2.3.1.-) / Pyruvate formate-lyase (EC 2.3.1.54) locus|ECP02999174_3618, protein_id|ENC53855.1, gi|476966127
3551 122961 121753 1209 - 33         Acetate kinase (EC 2.7.2.1) @ Propionate kinase (EC 2.7.2.15) locus|ECP02999174_3619, protein_id|ENC53856.1, gi|476966128
3552 124318 122987 1332 - 25         L-threonine transporter, anaerobically inducible locus|ECP02999174_3620, protein_id|ENC53857.1, gi|476966129
3553 125329 124340 990 - 21     1: 1 dlit(9484901) Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) locus|ECP02999174_3621, protein_id|ENC53858.1, gi|476966130

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Prolyl-tRNA_synthetase_associated_editing_enzymes howard.969 RidA/YER057c/UK114 superfamily protein


  Protein Sequence

>fig|1116050.3.peg.3549 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10)
MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAI
VVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLE
IEAIAVRSA

MD5 = 806d23732eecf3a07d4a5478b9c46f34


  DNA Sequence

>fig|1116050.3.peg.3549 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10)
atgaaaaagattatcgaaacgcaacgtgccccaggcgcaatcggcccttatgttcagggc
gttgatttaggcagcatggtcttcacctccgggcaaattccggtttgcccgcagaccggt
gagatcccggctgatgtgcaagatcaggcgcgtttaagcctcgaaaacgtcaaagcgatc
gtggttgctgccgggctgagcgtgggcgatatcatcaagatgaccgtgttcatcaccgat
ctgaatgattttgccaccatcaatgaagtctataagcagttcttcgatgagcatcaggcg
acctacccgacccggagctgtgtgcaggttgcgcgtttgccgaaagatgtgaagctggaa
attgaagctatcgcagtacgtagtgcgtaa


  DNA with Flanking Sequence

>fig|1116050.3.peg.3549 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10)
ccctacccagtcgattctgactatcacttctaacgtggtgtacggccagaaaaccggtaa
tacgccggacggtcgtcgcgccggaacaccgttcgcgccgggcgctaacccgatgcatgg
tcgtgaccgcaaaggtgccgtggcctcattgacgtcggtggcgaaactgccgttcaccta
cgccaaagatgggatctcgtacaccttctcaatcgttcctgcggcgctgggcaaagaaga
tccagtacgtaaaaccaaccttgtcggcctgctggatgggtatttccaccacgaagcgga
tgtcgaaggcggtcaacacctcaacgtcaacgtaatgaatcgggaaatgctgctggatgc
catcgagcacccggaaaaatatcctaccctgacaatccgtgtctctggctacgccgtgcg
cttcaacgcactgacccgtgaacagcaacaggatgttatttcacgtacttttacccaggc
gctctgacgccggaggatgtatgaaaaagattatcgaaacgcaacgtgccccaggcgcaa
tcggcccttatgttcagggcgttgatttaggcagcatggtcttcacctccgggcaaattc
cggtttgcccgcagaccggtgagatcccggctgatgtgcaagatcaggcgcgtttaagcc
tcgaaaacgtcaaagcgatcgtggttgctgccgggctgagcgtgggcgatatcatcaaga
tgaccgtgttcatcaccgatctgaatgattttgccaccatcaatgaagtctataagcagt
tcttcgatgagcatcaggcgacctacccgacccggagctgtgtgcaggttgcgcgtttgc
cgaaagatgtgaagctggaaattgaagctatcgcagtacgtagtgcgtaaagcctcgtga
gcgggacggtcgcaaggtcgttccgctccacttcactgaacggcaatccgagggtgtgga
tatgattagtgcattcgatattttcaaaattgggattggtccctccagttcgcataccgt
ggggccaatgaatgccggaaaaagttttattgatcggctggaaagtagcggcttattaac
cgcgacgagccatattgtggtcgatctgtatgggtcgttgtcactgacgggcaaaggcca
tgccacggatgtcgccattatcatgggactggcaggaaacagtccgcaggatgttgtcat
tgatgagatccctgcatttatagagttagtaacgcgcagcgggcggctgccagtggcatc
tggtgcgcatattgttgattttcctgtagcaaagaacattatcttccatcccgaaatgtt
gcctcgccatgagaacggaatgcggatcactgcctggaagggacaggaagcgctattaag
taaaacctat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(9484901);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search