The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.3548: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)
Translate Function Assignments



Context on contig APYN01000064 from base 112541 to 124318 (11778 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3542 113437 112541 897 -           Transcriptional regulator YhaJ, LysR family locus|ECP02999174_3611, protein_id|ENC53848.1, gi|476966120
3543 113641 114243 603 + 203         Pirin-like protein YhaK gene_name|yhaK, locus|ECP02999174_3612, protein_id|ENC53849.1, gi|476966121
3544 114263 114430 168 + 19         Uncharacterized protein YhaL locus|ECP02999174_3613, protein_id|ENC53850.1, gi|476966122
3545 114566 114420 147 - -11         FIG00643765: hypothetical protein  
3546 115952 114642 1311 - 75     2: 1 2   L-Cysteine Desulfidase locus|ECP02999174_3614, protein_id|ENC53851.1, gi|476966123
3547 117311 115980 1332 - 27         Cysteine permease CyuP gene_name|yhaO, locus|ECP02999174_3615, protein_id|ENC53852.1, gi|476966124
3548 118950 117586 1365 - 274     1: 4   L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17) locus|ECP02999174_3616, protein_id|ENC53853.1, gi|476966125
3549 119411 119022 390 - 71     1: 3 dlit(9484901) 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10) gene_name|tdcF, locus|ECP02999174_3617, protein_id|ENC53854.1, gi|476966126
3550 121719 119425 2295 - 13         2-ketobutyrate formate-lyase (EC 2.3.1.-) / Pyruvate formate-lyase (EC 2.3.1.54) locus|ECP02999174_3618, protein_id|ENC53855.1, gi|476966127
3551 122961 121753 1209 - 33         Acetate kinase (EC 2.7.2.1) @ Propionate kinase (EC 2.7.2.15) locus|ECP02999174_3619, protein_id|ENC53856.1, gi|476966128
3552 124318 122987 1332 - 25         L-threonine transporter, anaerobically inducible locus|ECP02999174_3620, protein_id|ENC53857.1, gi|476966129

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
YggSTF El_Yacoubi_Basma_user L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)


  Protein Sequence

>fig|1116050.3.peg.3548 L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)
MISAFDIFKIGIGPSSSHTVGPMNAGKSFIDRLESSGLLTATSHIVVDLYGSLSLTGKGH
ATDVAIIMGLAGNSPQDVVIDEIPAFIELVTRSGRLPVASGAHIVDFPVAKNIIFHPEML
PRHENGMRITAWKGQEALLSKTYYSVGGGFIVEEEHFGLSHDVETSVPYDFHSAGELLKM
CDYNGLSISGLMMHNELALRSKAEIDAGFARIWQVMHDGIERGMNTEGVLPGPLNVPRRA
VALRRQLVSSDNISNDPMNVIDWINMYALAVSEENAAGGRVVTAPTNGACGIIPAVLAYY
DKFRRPVNERSIARYFLAAGAIGALYKMNASISGAEVGCQGEIGVACSMAAAGLTELLGG
SPAQVCNAAEIAMEHNLGLTCDPVAGQVQIPCIERNAINAVKAVNAARMAMRRTSAPRVS
LDKVIETMYETGKDMNDKYRETSRGGLAIKVVCG

MD5 = d0b66cacc56ac5253f24dd971c89246f


  DNA Sequence

>fig|1116050.3.peg.3548 L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)
atgattagtgcattcgatattttcaaaattgggattggtccctccagttcgcataccgtg
gggccaatgaatgccggaaaaagttttattgatcggctggaaagtagcggcttattaacc
gcgacgagccatattgtggtcgatctgtatgggtcgttgtcactgacgggcaaaggccat
gccacggatgtcgccattatcatgggactggcaggaaacagtccgcaggatgttgtcatt
gatgagatccctgcatttatagagttagtaacgcgcagcgggcggctgccagtggcatct
ggtgcgcatattgttgattttcctgtagcaaagaacattatcttccatcccgaaatgttg
cctcgccatgagaacggaatgcggatcactgcctggaagggacaggaagcgctattaagt
aaaacctattactctgtcggcggcgggtttattgtcgaagaagaacacttcggcctgtcg
cacgatgtcgaaacgtccgtaccttacgatttccactcagcaggtgaactgctgaaaatg
tgtgattacaacggcctgtctatatctggcctgatgatgcacaacgagctagcgctgcgc
agtaaagcggaaattgacgcagggtttgcccgtatctggcaagtgatgcatgacggtatt
gaacgcgggatgaacactgaaggcgtgctgcctggtccgctcaatgtgccgcgtcgtgcc
gtagcgctgcgtcgtcagctggtttctagcgataacatctctaacgatccgatgaatgtc
atcgactggatcaacatgtacgcgctggcggttagtgaagaaaacgcagctggcgggcgc
gtggtaacggcaccgactaacggtgcgtgcggcattattccggcagtgctggcttattac
gataagttccgtcgtccggtaaacgagcggtcaattgcccgctattttctggcagcgggg
gctattggcgcgctgtataaaatgaacgcctccatctctggcgcggaggtcggctgtcag
ggggagattggcgtggcctgttcaatggcggcggcagggttaactgaactactgggcggc
agtccggcgcaggtatgcaatgcggcggaaatcgcgatggagcataaccttgggctgacc
tgcgatccggttgccggacaggtacaaatcccgtgcattgaacgtaatgccattaatgcc
gtgaaagcagtaaacgccgcgcggatggcgatgcgccgcacctcggcaccgcgtgtttca
ctcgataaagtgatcgagacgatgtatgaaaccggcaaagatatgaacgataaataccgc
gaaacatcacgcggaggactggccattaaagtggtctgcggctga


  DNA with Flanking Sequence

>fig|1116050.3.peg.3548 L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)
cacgtacttttacccaggcgctctgacgccggaggatgtatgaaaaagattatcgaaacg
caacgtgccccaggcgcaatcggcccttatgttcagggcgttgatttaggcagcatggtc
ttcacctccgggcaaattccggtttgcccgcagaccggtgagatcccggctgatgtgcaa
gatcaggcgcgtttaagcctcgaaaacgtcaaagcgatcgtggttgctgccgggctgagc
gtgggcgatatcatcaagatgaccgtgttcatcaccgatctgaatgattttgccaccatc
aatgaagtctataagcagttcttcgatgagcatcaggcgacctacccgacccggagctgt
gtgcaggttgcgcgtttgccgaaagatgtgaagctggaaattgaagctatcgcagtacgt
agtgcgtaaagcctcgtgagcgggacggtcgcaaggtcgttccgctccacttcactgaac
ggcaatccgagggtgtggatatgattagtgcattcgatattttcaaaattgggattggtc
cctccagttcgcataccgtggggccaatgaatgccggaaaaagttttattgatcggctgg
aaagtagcggcttattaaccgcgacgagccatattgtggtcgatctgtatgggtcgttgt
cactgacgggcaaaggccatgccacggatgtcgccattatcatgggactggcaggaaaca
gtccgcaggatgttgtcattgatgagatccctgcatttatagagttagtaacgcgcagcg
ggcggctgccagtggcatctggtgcgcatattgttgattttcctgtagcaaagaacatta
tcttccatcccgaaatgttgcctcgccatgagaacggaatgcggatcactgcctggaagg
gacaggaagcgctattaagtaaaacctattactctgtcggcggcgggtttattgtcgaag
aagaacacttcggcctgtcgcacgatgtcgaaacgtccgtaccttacgatttccactcag
caggtgaactgctgaaaatgtgtgattacaacggcctgtctatatctggcctgatgatgc
acaacgagctagcgctgcgcagtaaagcggaaattgacgcagggtttgcccgtatctggc
aagtgatgcatgacggtattgaacgcgggatgaacactgaaggcgtgctgcctggtccgc
tcaatgtgccgcgtcgtgccgtagcgctgcgtcgtcagctggtttctagcgataacatct
ctaacgatccgatgaatgtcatcgactggatcaacatgtacgcgctggcggttagtgaag
aaaacgcagctggcgggcgcgtggtaacggcaccgactaacggtgcgtgcggcattattc
cggcagtgctggcttattacgataagttccgtcgtccggtaaacgagcggtcaattgccc
gctattttctggcagcgggggctattggcgcgctgtataaaatgaacgcctccatctctg
gcgcggaggtcggctgtcagggggagattggcgtggcctgttcaatggcggcggcagggt
taactgaactactgggcggcagtccggcgcaggtatgcaatgcggcggaaatcgcgatgg
agcataaccttgggctgacctgcgatccggttgccggacaggtacaaatcccgtgcattg
aacgtaatgccattaatgccgtgaaagcagtaaacgccgcgcggatggcgatgcgccgca
cctcggcaccgcgtgtttcactcgataaagtgatcgagacgatgtatgaaaccggcaaag
atatgaacgataaataccgcgaaacatcacgcggaggactggccattaaagtggtctgcg
gctgacattgctgtcagctttcatccttgggtgcacaaatgtgcaccttttttttgtgat
ctgccgcaaatagagaatgaatattctcttgcgattaatttagtagaaaattcttatcca
tctccgttatttcaaagtcttgattgtgaagattttctctgacctcgcgcgtatcatttc
tttattctaataactcgcctgcaaaaacgtagaccgcatatcgccttgatgcggctcgga
aaaaaataataagccctacaaaatattgagcgagaaattatggaaattgcatcgaataaa
ggcgtcattgcagacgcttcgaccccggcgggtcgtgctggaatgagtgagagcgagtgg
cgagaagcgatcaaattcgacagtactgacaccggctgggtgattatgagtatcgggatg
gcgattggcgcggggattgtttttctcccggtgcaggtcggtttgatgggattgtgggta
tttttgctctcatcggtgattggtt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search