The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.3545: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: FIG00643765: hypothetical protein
Translate Function Assignments



Context on contig APYN01000064 from base 109301 to 121719 (12419 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3537 109301 109600 300 +           Inner membrane protein YqjK locus|ECP02999174_3606, protein_id|ENC53843.1, gi|476966115
3538 109696 110178 483 + 95         Inner membrane protein YqjF gene_name|yqjF, locus|ECP02999174_3607, protein_id|ENC53844.1, gi|476966116
3539 110248 111234 987 + 69         Glutathione S-transferase, omega (EC 2.5.1.18) locus|ECP02999174_3608, protein_id|ENC53845.1, gi|476966117
3540 111527 111892 366 + 292         Inner membrane protein YhaI gene_name|yhaH, locus|ECP02999174_3609, protein_id|ENC53846.1, gi|476966118
3541 112134 112490 357 + 241         Inner membrane protein YhaI gene_name|yhaI, locus|ECP02999174_3610, protein_id|ENC53847.1, gi|476966119
3542 113437 112541 897 - 50         Transcriptional regulator YhaJ, LysR family locus|ECP02999174_3611, protein_id|ENC53848.1, gi|476966120
3543 113641 114243 603 + 203         Pirin-like protein YhaK gene_name|yhaK, locus|ECP02999174_3612, protein_id|ENC53849.1, gi|476966121
3544 114263 114430 168 + 19         Uncharacterized protein YhaL locus|ECP02999174_3613, protein_id|ENC53850.1, gi|476966122
3545 114566 114420 147 - -11         FIG00643765: hypothetical protein  
3546 115952 114642 1311 - 75     2: 1 3   L-Cysteine Desulfidase locus|ECP02999174_3614, protein_id|ENC53851.1, gi|476966123
3547 117311 115980 1332 - 27         Cysteine permease CyuP gene_name|yhaO, locus|ECP02999174_3615, protein_id|ENC53852.1, gi|476966124
3548 118950 117586 1365 - 274     1: 2   L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17) locus|ECP02999174_3616, protein_id|ENC53853.1, gi|476966125
3549 119411 119022 390 - 71     1: 4 dlit(9484901) 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10) gene_name|tdcF, locus|ECP02999174_3617, protein_id|ENC53854.1, gi|476966126
3550 121719 119425 2295 - 13         2-ketobutyrate formate-lyase (EC 2.3.1.-) / Pyruvate formate-lyase (EC 2.3.1.54) locus|ECP02999174_3618, protein_id|ENC53855.1, gi|476966127

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116050.3.peg.3545 FIG00643765: hypothetical protein
MLLCFVPDAGCDAGASYPAYGLFNSLMLLDFVGRIRRFRRIRQPVFTR

MD5 = d27d3dad80247ee1da8e37eaaf5b4fbe


  DNA Sequence

>fig|1116050.3.peg.3545 FIG00643765: hypothetical protein
atgttgttgtgttttgtacctgatgccggatgcgatgctggcgcatcttatccggcctac
gggttgtttaattcgttaatgttgttggattttgtaggccggataaggcgttttcgccgc
atccggcaacctgtctttacgcggtag


  DNA with Flanking Sequence

>fig|1116050.3.peg.3545 FIG00643765: hypothetical protein
aacggctggcgcgtgcgctgatgctttctcatttgagcgcaatttacatccataaccagt
taccgcgtttgtctgcgctgtgtgccgcaacgaccgcagcaatgggggccgccgccggga
tggcatggctggtggatgggcgttatgaaaccatctcgatggcgatcagcagtatgatcg
gcgatgtcagcggcatgatttgcgatggtgcgtcgaacagctgcgcgatgaaggtttcga
ccagtgcttcggctgcgtggaaagcggtgttaatggcgctggatgataccgccgtgaccg
gcaatgaagggatcgtggcgcatgatgttgagcagtcgattgccaacctgtgtgcgttag
caagccattcgatgcagcaaacggatcggcagattatcgagattatggcgagcaaggcca
gataaacgccaggttttgggtatcgtgccggatgcgatgctggcgcaccttatccggcct
acggggtgctcaacttgttgatgttgttgtgttttgtacctgatgccggatgcgatgctg
gcgcatcttatccggcctacgggttgtttaattcgttaatgttgttggattttgtaggcc
ggataaggcgttttcgccgcatccggcaacctgtctttacgcggtagcttcatcctcggc
taaacgcgtttcagcatccgcgacgatggcttccagctcgctcaacatctcttcatagcc
aaaatttttggcggtgcgagcaggttctttcgccaccacgggcttcactggctggcgctt
tttggccgattttttactcatcatcatctccctgtaaaaacaactagacaggcaaatcta
tcagcaaagcgcgcagtggggaatcggcaaccagcgtaatgttagcctcgtcacgaataa
acgccccatcaccgcaggtcagcgccgctttctcttcatgatgcgtaagcgcatgaaatt
tcccgtgaatcgattgcaaatacgcgcgtggcccatgcaactggaaattcgcactttcgc
ctttgtcgagcacgatatggtgcagccacacttgctggcgtaattgcaggcttcccatcg
taccctctggcgaggcgattaattgctgcttgcccatattaagcgccagtttttgaatca
gcggatt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search