The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.2786: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: NADP-dependent malic enzyme (EC 1.1.1.40)
Translate Function Assignments



Context on contig APYN01000050 from base 40885 to 54016 (13132 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2778 42288 40885 1404 -           Acetaldehyde dehydrogenase, ethanolamine utilization cluster locus|ECP02999174_2840, protein_id|ENC54806.1, gi|476967183
2779 42587 42300 288 - 11         Ethanolamine utilization polyhedral-body-like protein EutN gene_name|eutN, locus|ECP02999174_2841, protein_id|ENC54807.1, gi|476967184
2780 42987 42694 294 - 106         Ethanolamine utilization polyhedral-body-like protein EutM gene_name|eutM, locus|ECP02999174_2842, protein_id|ENC54808.1, gi|476967185
2781 44042 43026 1017 - 38         Phosphate acetyltransferase (EC 2.3.1.8), ethanolamine utilization-specific locus|ECP02999174_2843, protein_id|ENC54809.1, gi|476967186
2782 44842 44039 804 - -4         ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17), ethanolamine utilization locus|ECP02999174_2844, protein_id|ENC54810.1, gi|476967187
2783 45540 44839 702 - -4         Ethanolamine utilization protein EutQ gene_name|eutQ, locus|ECP02999174_2845, protein_id|ENC54811.1, gi|476967188
2784 45994 45515 480 - -26         Ethanolamine utilization protein EutP gene_name|eutP, locus|ECP02999174_2846, protein_id|ENC54812.1, gi|476967189
2785 46342 46007 336 - 12         Ethanolamine utilization polyhedral-body-like protein EutS gene_name|eutS, locus|ECP02999174_2847, protein_id|ENC54813.1, gi|476967190
2786 48914 46635 2280 - 292         NADP-dependent malic enzyme (EC 1.1.1.40) gene_name|maeB, locus|ECP02999174_2848, protein_id|ENC54814.1, gi|476967191
2787 49203 50153 951 + 288     1: 1 dlit(17046540) Transaldolase (EC 2.2.1.2) locus|ECP02999174_2849, protein_id|ENC54815.1, gi|476967192
2788 50173 52176 2004 + 19     1: 1   Transketolase (EC 2.2.1.1) locus|ECP02999174_2850, protein_id|ENC54816.1, gi|476967193
2789 52169 52282 114 + -8         FIG00637946: hypothetical protein locus|ECP02999174_2851, protein_id|ENC54817.1, gi|476967194
2790 53315 52272 1044 - -11         Putative exported protein locus|ECP02999174_2852, protein_id|ENC54818.1, gi|476967195
2791 54016 53441 576 - 125         GDP-mannose pyrophosphatase YffH gene_name|nudK, locus|ECP02999174_2853, protein_id|ENC54819.1, gi|476967196

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116050.3.peg.2786 NADP-dependent malic enzyme (EC 1.1.1.40)
MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKY
TARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFI
EVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRV
VEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAY
AVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKE
VRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQS
EVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKL
TEFVYKTNLFMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIE
MRIQKLGLQIKAGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIG
AIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYV
NDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRDRAP
DLMIDGEMHGDAALVEAIRNDRMPDSPLKGSANILVMPNMEAARISYNLLRVSSSEGVTV
GPVLMGVAKPVHVLTPIASVRRIVNMVALAVVEAQTQPL

MD5 = e4ebaf8909957a0c9f12b987e637062a


  DNA Sequence

>fig|1116050.3.peg.2786 NADP-dependent malic enzyme (EC 1.1.1.40)
atggatgaccagttaaaacaaagtgcacttgatttccatgaatttccagttccagggaaa
atccaggtttctccaaccaagcctctggcaacgcagcgcgatctggcgctggcctactca
ccaggcgttgccgcaccttgtcttgaaatcgaaaaagacccgttaaaagcctacaaatat
accgcgcgcggtaacctggtggcggtgatctctaacggtacggcggtgctggggttaggc
aacattggcgcgctggctggcaaaccggtgatggaaggcaagggcgttctgtttaagaaa
ttcgccgggattgatgtatttgacattgaagttgatgaactcgacccggacaaatttatt
gaagttgtcgctgcgctcgaaccgaccttcggcggaatcaacctcgaagacattaaagcg
ccagaatgtttctatattgaacagaaactgcgcgagcggatgaatattccggtattccac
gacgatcagcacggcacggcaatcatcagcactgccgccatcctcaacggcttgcgcgtg
gtggagaaaaacatctccgacgtgcggatggtggtttccggcgcgggtgccgcagcaatc
gcctgtatgaacctgctggtagcgctgggtctgcaaaaacataacatcgtggtttgcgat
tcaaaaggcgttatctatcagggccgtgagccaaacatggcggaaaccaaagccgcatat
gcggtggtggatgacggcaaacgtaccctcgatgatgtgattgaaggcgcggatattttc
ctcggatgttccggcccgaaagtgctgacccaggaaatggtgaagaaaatggctcgtgcg
ccaatgatcctggcgctggcgaacccggaaccggaaattctgccgccgctggcgaaagaa
gtgcgtccggatgccatcatctgcaccggtcgttctgactatccaaaccaggtcaacaac
gtcctttgcttcccgttcatcttccgtggcgcgctggacgttggcgcaaccgccatcaac
gaagagatgaaactggcggcggtacgcgcgattgcagaactggcccacgccgaacagagc
gaagtggtggcttcagcgtatggcgatcaggatctgagctttggtccggaatacatcatt
ccaaaaccgtttgatccgcgcttgatcgttaagatcgctcctgcggtggcgaaagcggcg
atggagtcgggcgtggcgacgcgtccgattgctgatttcgacgtctacatcgacaagctg
actgagttcgtttacaaaaccaacctgtttatgaagccgattttctcccaggctcgcaaa
gcgccgaagcgcgtagttctgccggaaggggaagaggcgcgcgttctgcatgccactcag
gaactggtaacgctgggactggcgaaaccgatccttatcggtcgtccgaacgtgatcgaa
atgcgcattcagaaactgggcttgcagatcaaagcgggcgttgattttgagatcgtcaat
aacgaatccgatccgcgctttaaagagtactggaccgaatacttccagatcatgaagcgt
cgcggtgtcactcaggaacaggcgcagcgggcgctgatcagtaacccgacagtgatcggc
gcgatcatggttcagcgtggggaagccgatgcaatgatctgcggtacggtgggcgattat
catgaacattttagcgtggtgaaaaatgtctttggttatcgcgatggcgttcacaccgca
ggtgcaatgaacgcgctgctgctgccgagtggtaacacctttattgccgatacctacgtc
aatgacgaaccagacgcagaagagctggcggagatcaccttgatggcggcagaaactgtc
cgtcgttttggtattgagccgcgcgttgctctgttgtcgcactccaactttggttcttct
gactgcccgtcgtcgagcaaaatgcgtcaggcgctggaactggtcagggatcgtgcgcca
gatctgatgattgatggtgaaatgcacggcgatgcagcgctggtggaagcgattcgcaac
gaccgtatgccggacagccctttgaaaggttctgccaatattctggtgatgccgaacatg
gaagctgcccgcattagttacaacttactgcgcgtttccagctcggaaggtgtgactgtc
ggtccggtgctgatgggcgtggcgaaaccggttcacgtgttaacgccgatcgcatcggtg
cgtcgtatcgtcaacatggtggcgctggccgtggttgaagcgcaaacccaaccgctgtaa


  DNA with Flanking Sequence

>fig|1116050.3.peg.2786 NADP-dependent malic enzyme (EC 1.1.1.40)
gcgaccacctgttgttcctgggtcttgccattttttttaccccaggcgatagcatcgtct
attaaatgctcatattgtgataatccggcagccttgagtaacagcgaaggattggtggtg
gcatcctggggatgataatggcgaatggactcaatatcgccgctgtctgccacgacagtg
gtgaactgtttgatgccgtctaactcgttcataggaaatactccttgaaaagtaaagtgt
tagatgagtgcgttaattcacacttctgagaaatttcgctaaacgcatcaaaaaagcata
gcagacaggcatggtattgctggattaagcaggtaacatcagtgttataggattattacc
aaaacattatattaatggtgagagtttggacttgctcaaagtctgtagactccggcaggg
taataatgtgcgccacgttgtgggcaggggctgttgcccacacactttatttgtgaacgt
tacgtgaaaggaacaaccaaatggatgaccagttaaaacaaagtgcacttgatttccatg
aatttccagttccagggaaaatccaggtttctccaaccaagcctctggcaacgcagcgcg
atctggcgctggcctactcaccaggcgttgccgcaccttgtcttgaaatcgaaaaagacc
cgttaaaagcctacaaatataccgcgcgcggtaacctggtggcggtgatctctaacggta
cggcggtgctggggttaggcaacattggcgcgctggctggcaaaccggtgatggaaggca
agggcgttctgtttaagaaattcgccgggattgatgtatttgacattgaagttgatgaac
tcgacccggacaaatttattgaagttgtcgctgcgctcgaaccgaccttcggcggaatca
acctcgaagacattaaagcgccagaatgtttctatattgaacagaaactgcgcgagcgga
tgaatattccggtattccacgacgatcagcacggcacggcaatcatcagcactgccgcca
tcctcaacggcttgcgcgtggtggagaaaaacatctccgacgtgcggatggtggtttccg
gcgcgggtgccgcagcaatcgcctgtatgaacctgctggtagcgctgggtctgcaaaaac
ataacatcgtggtttgcgattcaaaaggcgttatctatcagggccgtgagccaaacatgg
cggaaaccaaagccgcatatgcggtggtggatgacggcaaacgtaccctcgatgatgtga
ttgaaggcgcggatattttcctcggatgttccggcccgaaagtgctgacccaggaaatgg
tgaagaaaatggctcgtgcgccaatgatcctggcgctggcgaacccggaaccggaaattc
tgccgccgctggcgaaagaagtgcgtccggatgccatcatctgcaccggtcgttctgact
atccaaaccaggtcaacaacgtcctttgcttcccgttcatcttccgtggcgcgctggacg
ttggcgcaaccgccatcaacgaagagatgaaactggcggcggtacgcgcgattgcagaac
tggcccacgccgaacagagcgaagtggtggcttcagcgtatggcgatcaggatctgagct
ttggtccggaatacatcattccaaaaccgtttgatccgcgcttgatcgttaagatcgctc
ctgcggtggcgaaagcggcgatggagtcgggcgtggcgacgcgtccgattgctgatttcg
acgtctacatcgacaagctgactgagttcgtttacaaaaccaacctgtttatgaagccga
ttttctcccaggctcgcaaagcgccgaagcgcgtagttctgccggaaggggaagaggcgc
gcgttctgcatgccactcaggaactggtaacgctgggactggcgaaaccgatccttatcg
gtcgtccgaacgtgatcgaaatgcgcattcagaaactgggcttgcagatcaaagcgggcg
ttgattttgagatcgtcaataacgaatccgatccgcgctttaaagagtactggaccgaat
acttccagatcatgaagcgtcgcggtgtcactcaggaacaggcgcagcgggcgctgatca
gtaacccgacagtgatcggcgcgatcatggttcagcgtggggaagccgatgcaatgatct
gcggtacggtgggcgattatcatgaacattttagcgtggtgaaaaatgtctttggttatc
gcgatggcgttcacaccgcaggtgcaatgaacgcgctgctgctgccgagtggtaacacct
ttattgccgatacctacgtcaatgacgaaccagacgcagaagagctggcggagatcacct
tgatggcggcagaaactgtccgtcgttttggtattgagccgcgcgttgctctgttgtcgc
actccaactttggttcttctgactgcccgtcgtcgagcaaaatgcgtcaggcgctggaac
tggtcagggatcgtgcgccagatctgatgattgatggtgaaatgcacggcgatgcagcgc
tggtggaagcgattcgcaacgaccgtatgccggacagccctttgaaaggttctgccaata
ttctggtgatgccgaacatggaagctgcccgcattagttacaacttactgcgcgtttcca
gctcggaaggtgtgactgtcggtccggtgctgatgggcgtggcgaaaccggttcacgtgt
taacgccgatcgcatcggtgcgtcgtatcgtcaacatggtggcgctggccgtggttgaag
cgcaaacccaaccgctgtaattcttttttaactctcacgcttaccctgaatattcagggt
aagcggtttggctgcaatatattagtaaagcttattactgagtttgcgaataataaaaaa
agcagtctatataatatctcgatattattttatttatattcatgcgttgcatatgaaagt
ttatgcaccacagcgaatatctctccattcttagtgatctacctcaccttttaaacgcgc
ttgccgaattttgttatttactctgacgaaaaattgtcacgatacacgaaagtttttcac
aggcggcgactcatggataaagaacgcatcattcaggaatttgtgcccggcaaacaggtc
acactggcgcatctcatcgcgcatcccggtgaggaactggcgaagaaaatcggcgttccg
gatgcgggcgcaattggcattatgacgctaactcccggcgaaacggcgatgatcgccggt
gatttagcgctgaaagccgctgatgtgcatatcggttttc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search