The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.2624: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: Positive transcription regulator EvgA
Translate Function Assignments



Context on contig APYN01000049 from base 65183 to 77629 (12447 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2619 66241 65183 1059 -           Sucrose specific transcriptional regulator CscR, LacI family locus|ECP02999174_2671, protein_id|ENC55055.1, gi|476967435
2620 66409 66627 219 + 167         -serine permease DsdX # fragment locus|ECP02999174_2672, protein_id|ENC55056.1, gi|476967436
2621 66645 67973 1329 + 17         D-serine ammonia-lyase (EC 4.3.1.18) gene_name|dsdA, locus|ECP02999174_2673, protein_id|ENC55057.1, gi|476967437
2622 69619 68081 1539 - 107         Inner membrane component of tripartite multidrug resistance system locus|ECP02999174_2674, protein_id|ENC55058.1, gi|476967438
2623 70782 69619 1164 - -1         Membrane fusion component of tripartite multidrug resistance system locus|ECP02999174_2675, protein_id|ENC55059.1, gi|476967439
2624 71198 71812 615 + 415       dlit(11914367) Positive transcription regulator EvgA gene_name|evgA, locus|ECP02999174_2676, protein_id|ENC55060.1, gi|476967440
2625 72027 75410 3384 + 214         Hybrid sensory histidine kinase in two-component regulatory system with EvgA gene_name|evgS, locus|ECP02999174_2677, protein_id|ENC55061.1, gi|476967441
2626 76611 75466 1146 - 55         YfdE protein locus|ECP02999174_2678, protein_id|ENC55062.1, gi|476967442
2627 77629 76685 945 - 73         Uncharacterized transporter YfdV locus|ECP02999174_2679, protein_id|ENC55063.1, gi|476967443

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116050.3.peg.2624 Positive transcription regulator EvgA
MNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNG
IQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGY
CYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKS
RLMEKLECKSLMDLYTFAQRNKIG

MD5 = 0fc39431cf45f67ef9e76c9a1f225d7f


  DNA Sequence

>fig|1116050.3.peg.2624 Positive transcription regulator EvgA
atgaacgcaataattattgatgaccatcctcttgctatcgcagcaattcgtaatttattg
atcaaaaacgatattgaaatcttagcggagttgactgaagggggaagcgccgttcagcgg
gtggaaacacttaagcctgatatcgtcatcattgatgtcgatatccccggagttaacggt
atccaggtgttagaaacgctgaggaagcgccaatatagcggaattattattattgtctcc
gctaaaaatgaccatttttacgggaaacattgtgctgatgctggcgctaatggattcgtg
agtaaaaaagaaggcatgaacaatatcattgcggctattgaagctgcaaaaaatggctac
tgctatttccccttctctctcaaccggtttgttggaagtttaacgtccgaccagcaaaaa
ctcgactccttatcgaaacaagaaattagtgtcatgcggtatattcttgatggcaaggat
aataatgacattgctgaaaaaatgttcatcagcaacaaaactgtcagcacttataaaagt
cgcctgatggaaaaattagaatgtaaatcactgatggatctttacacattcgcgcaacgt
aacaaaatcggctaa


  DNA with Flanking Sequence

>fig|1116050.3.peg.2624 Positive transcription regulator EvgA
aaaacgcaataaataaaactaccgccaataaagaaaagtattttcttctgttagaatgtt
ttttatttgaattaatctgttccactattatctctcatttctcatagatgaaatttatga
attgaatgaaaagagcattcattcttcatatcaaacacagtgcatgtgttgcacattatc
ccaggaacgttggaggcctaatttaaatgaggtgcaaaaaaaacaacagaggactaaacc
gtggcttttgcaatacaattcttacgcctgtaggattagtgagaagacttatagtgctaa
cttgaaactataaatcatcggtataatccctgattttattgttgacatttcatttatgcc
gactatttatatggtatacttgtcgaattatcttaaaggaagctcagattttcttatttt
tattgagaaaatgagatgacgccttatgtctgtattactacagggagaagggagatgctt
cattgcaaagggaataatctatgaacgcaataattattgatgaccatcctcttgctatcg
cagcaattcgtaatttattgatcaaaaacgatattgaaatcttagcggagttgactgaag
ggggaagcgccgttcagcgggtggaaacacttaagcctgatatcgtcatcattgatgtcg
atatccccggagttaacggtatccaggtgttagaaacgctgaggaagcgccaatatagcg
gaattattattattgtctccgctaaaaatgaccatttttacgggaaacattgtgctgatg
ctggcgctaatggattcgtgagtaaaaaagaaggcatgaacaatatcattgcggctattg
aagctgcaaaaaatggctactgctatttccccttctctctcaaccggtttgttggaagtt
taacgtccgaccagcaaaaactcgactccttatcgaaacaagaaattagtgtcatgcggt
atattcttgatggcaaggataataatgacattgctgaaaaaatgttcatcagcaacaaaa
ctgtcagcacttataaaagtcgcctgatggaaaaattagaatgtaaatcactgatggatc
tttacacattcgcgcaacgtaacaaaatcggctaatcacatgaagtttttaccctatttt
tttcttctctgttgtggtctttggtcgaccataagtttcgcagacgaagattacatcgaa
tatcgtggcatcagtagtaacaaccgtgtcacacttgatccagtacgtctgagcaacaag
gaattacgttggttagcgagcaaaaaaaatcttgtgattgcagtacacaagtcccaaacg
gctaccttgttgcataccgattcgcagcaacaggttcgtggtattaatgctgattattta
aatcttttaaaaagagcgttaaatatcaaattaacactccgggaatacgccgatcatcaa
aaagcaatggacgcgcttgcagaaggtgaagtcgatatagtgttatcacatttagttact
tcgccgcctcttaatagtgacattgctgcaaccaaaccattgataattacctttccggcg
ctggtaaccacccttcacgactcaatgcgaccgcttacctcaccaaaaccagtaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(11914367);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search