The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.2619: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: Sucrose specific transcriptional regulator CscR, LacI family
Translate Function Assignments



Context on contig APYN01000049 from base 59769 to 71812 (12044 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2615 59769 60701 933 +           Inner membrane protein YfdC gene_name|yfdC, locus|ECP02999174_2666, protein_id|ENC55051.1, gi|476967431
rna.45 60777 60848 72 + 75         tRNA-Arg-CCT  
2616 62540 61293 1248 - 444     1: 1   Sucrose permease, major facilitator superfamily locus|ECP02999174_2668, protein_id|ENC55052.1, gi|476967432
2617 63526 62612 915 - 71         Fructokinase (EC 2.7.1.4) locus|ECP02999174_2669, protein_id|ENC55053.1, gi|476967433
2618 63850 65175 1326 + 323     1: 1   Sucrose-6-phosphate hydrolase (EC 3.2.1.B3) locus|ECP02999174_2670, protein_id|ENC55054.1, gi|476967434
2619 66241 65183 1059 - 7         Sucrose specific transcriptional regulator CscR, LacI family locus|ECP02999174_2671, protein_id|ENC55055.1, gi|476967435
2620 66409 66627 219 + 167         -serine permease DsdX # fragment locus|ECP02999174_2672, protein_id|ENC55056.1, gi|476967436
2621 66645 67973 1329 + 17         D-serine ammonia-lyase (EC 4.3.1.18) gene_name|dsdA, locus|ECP02999174_2673, protein_id|ENC55057.1, gi|476967437
2622 69619 68081 1539 - 107         Inner membrane component of tripartite multidrug resistance system locus|ECP02999174_2674, protein_id|ENC55058.1, gi|476967438
2623 70782 69619 1164 - -1         Membrane fusion component of tripartite multidrug resistance system locus|ECP02999174_2675, protein_id|ENC55059.1, gi|476967439
2624 71198 71812 615 + 415       dlit(11914367) Positive transcription regulator EvgA gene_name|evgA, locus|ECP02999174_2676, protein_id|ENC55060.1, gi|476967440

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116050.3.peg.2619 Sucrose specific transcriptional regulator CscR, LacI family
MDLASDVCFCYSARFTANGLGMASLKDVARLAGVSMMTVSRVMHNAESVRPATRDRVLQA
IQTLNYVPDLSARKMRAQGRKPSTLAVLAQDTATTPFSVDILLAIEQTASEFGWNSFLIN
IFSEDDAARAARQLLAHRPDGIIYTTMGLRHITLPESLYGENIVLANCVADDPALPSYIP
DDYTAQYESTQHLLAAGYRQPLCFWLPESALATGYRRQGFEQAWRDAGRDLAEVKQFHMA
TGDDHYTDLASLLNDHFKSGKPDFDVLICGNDRAAFVAYQVLLAKGVRIPQDVAVMGFDN
LVGVGHLFLPPLTTIQLPHDIIGREAALHIIEGREGGRVTRIPCPLLIRCST

MD5 = 6e8ecfe1210ce937eaf0be55d64a610a


  DNA Sequence

>fig|1116050.3.peg.2619 Sucrose specific transcriptional regulator CscR, LacI family
ttggatctcgccagtgacgtctgtttctgctacagtgcccgttttacggcaaacggcttg
ggtatggcttcattaaaggatgtcgcacgcctggcgggagtgtcgatgatgacagtctcc
cgggtgatgcataatgcagaatctgtgcgtcctgcaacgcgtgaccgcgtattgcaggca
atccagaccctgaattatgttcctgatctttccgcccgtaagatgcgcgctcaaggacgt
aagccgtcgactctcgccgtgctggcgcaggacacggctaccactcctttctctgttgat
attctgcttgccattgagcaaaccgccagcgagttcggctggaatagttttttaatcaat
attttttctgaagatgacgctgcccgcgcggcacgtcagctgcttgcccaccgtccggat
ggcattatctatactacaatggggctgcgacatatcacgctgcctgagtctctgtatggt
gaaaatattgtattggcgaactgtgtggcggatgacccagcgttacccagttatatccct
gatgattacactgcacaatatgaatcaacacagcatttgctcgcggcgggctatcgtcaa
ccgttatgcttctggctaccggaaagtgcgttggcaacagggtatcgtcggcagggattt
gagcaggcctggcgtgatgctggacgagatctggctgaggtgaaacaatttcacatggca
acaggtgatgatcactacaccgatctcgcaagtttactcaatgaccacttcaaatcgggc
aaaccagattttgatgttctgatatgtggtaacgatcgcgcagcctttgtggcttatcag
gttcttctggcgaagggggtacgaatcccgcaggatgtcgccgtaatgggctttgataat
ctggttggcgtcgggcatctgtttttaccgccgctgaccacaattcagcttccacatgac
attatcgggcgggaagctgcattgcatattattgaaggtcgtgaagggggaagagtgacg
cggatcccttgcccgctgttgatccgttgttccacctga


  DNA with Flanking Sequence

>fig|1116050.3.peg.2619 Sucrose specific transcriptional regulator CscR, LacI family
tcgtgccaggattaaaccaggtggtttctttaagagcaaccagatcctttaccaacggat
actgggcgatgagcgagttcattttagcgttttccatagtacgtctctttgcgcttagat
gataaatgacagcaggaatgtgcccgccagagcgacgactgaagcgataaatgtcgctgt
cgtatagtatttaaatgtttcattgagcgtagcgccgcaatattgcttcactagccagaa
aagcgagtccgtaacgatcgtgcagccaattgcacctgaaccgatagcaatcgcaataat
ttccgggctgatgtcgggatacagcggcagcacaatgatccatatttatattttcttctc
caggttggcgatgccagttggcatgttttacttacttgcctatatggttactcgttggcg
agaacagaggcggaattggggacaattgtccgggaattattgttattttttattgtattg
ctgtgtcaggtgatagggcgttggatctcgccagtgacgtctgtttctgctacagtgccc
gttttacggcaaacggcttgggtatggcttcattaaaggatgtcgcacgcctggcgggag
tgtcgatgatgacagtctcccgggtgatgcataatgcagaatctgtgcgtcctgcaacgc
gtgaccgcgtattgcaggcaatccagaccctgaattatgttcctgatctttccgcccgta
agatgcgcgctcaaggacgtaagccgtcgactctcgccgtgctggcgcaggacacggcta
ccactcctttctctgttgatattctgcttgccattgagcaaaccgccagcgagttcggct
ggaatagttttttaatcaatattttttctgaagatgacgctgcccgcgcggcacgtcagc
tgcttgcccaccgtccggatggcattatctatactacaatggggctgcgacatatcacgc
tgcctgagtctctgtatggtgaaaatattgtattggcgaactgtgtggcggatgacccag
cgttacccagttatatccctgatgattacactgcacaatatgaatcaacacagcatttgc
tcgcggcgggctatcgtcaaccgttatgcttctggctaccggaaagtgcgttggcaacag
ggtatcgtcggcagggatttgagcaggcctggcgtgatgctggacgagatctggctgagg
tgaaacaatttcacatggcaacaggtgatgatcactacaccgatctcgcaagtttactca
atgaccacttcaaatcgggcaaaccagattttgatgttctgatatgtggtaacgatcgcg
cagcctttgtggcttatcaggttcttctggcgaagggggtacgaatcccgcaggatgtcg
ccgtaatgggctttgataatctggttggcgtcgggcatctgtttttaccgccgctgacca
caattcagcttccacatgacattatcgggcgggaagctgcattgcatattattgaaggtc
gtgaagggggaagagtgacgcggatcccttgcccgctgttgatccgttgttccacctgat
attatgttaacccagtagccagagtgctccatgttgcagcacagccactccgtgggaggc
ataaagcgacagttcccgttcttctggctgcggatagattcgactactcatcaccgcttc
cccgtcgttaataaatacttccacggatgatgtatcgataaatatccttagggcgagcgt
gtcacgctgcgggaggggaatactacggtagccgtctaaattctcgtgtgggtaataccg
ccacaaaacaagtcgctcagattggttatcaatatacagccgcattccagtgccgagctg
taatccgtaatgttcggcatcactgttcttcagcgcccactgcaactgaatctcaactgc
ttgcgcgttgtcctgcaaaacatatttattgctgattgtgcggggagagacagattgatg
ctgctggcgtaacgactcagcttcgtgtaccgggcgttgtagaagtttgccattgctctc
tgatagctcgcgcgccagc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search