The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.2610: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)
Translate Function Assignments



Context on contig APYN01000049 from base 46833 to 60701 (13869 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2606 49475 46833 2643 -           Fimbriae usher protein StfC locus|ECP02999174_2655, protein_id|ENC55040.1, gi|476967420
2607 50120 49557 564 - 81         Major fimbrial subunit StfA locus|ECP02999174_2656, protein_id|ENC55041.1, gi|476967421
2608 51280 50795 486 - 674       dlit(9489669) Phosphohistidine phosphatase SixA gene_name|sixA, locus|ECP02999174_2657, protein_id|ENC55042.1, gi|476967422
2609 53627 51483 2145 - 202         Enoyl-CoA hydratase (EC 4.2.1.17) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3) gene_name|fadJ, locus|ECP02999174_2659, protein_id|ENC55044.1, gi|476967424
2610 54937 53627 1311 - -1         3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9) gene_name|fadI, locus|ECP02999174_2660, protein_id|ENC55045.1, gi|476967425
2611 55401 55117 285 - 179         UPF0381 protein YfcZ locus|ECP02999174_2661, protein_id|ENC55046.1, gi|476967426
2612 55773 57113 1341 + 371         Long-chain fatty acid transport protein locus|ECP02999174_2662, protein_id|ENC55047.1, gi|476967427
2613 57480 58538 1059 + 366         FIG00639023: hypothetical protein locus|ECP02999174_2663, protein_id|ENC55048.1, gi|476967428
2614 59475 58720 756 - 181         Outer-membrane-phospholipid-binding lipoprotein MlaA locus|ECP02999174_2664, protein_id|ENC55049.1, gi|476967429
2615 59769 60701 933 + 293         Inner membrane protein YfdC gene_name|yfdC, locus|ECP02999174_2666, protein_id|ENC55051.1, gi|476967431

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116050.3.peg.2610 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)
MGQVLPLVTRQGDRIAIVSGLRTPFARQGTAFHGIPAVDLGKMVVGELLARSEIPAEVIE
QLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKKLARVLVDVNKARTMSQRLKLFSRLRLRDLMPVPPAVAEYST
GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWSDGKLKEEVMTAFIPPYKQPLVE
DNNIRGNSSLADYAKLRPAFDRKHGTVTAANSTPLTDGAAAGILMTESRAKELGLVPLGY
LRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMSDLTLIDMHEAFAAQTLANIQLLGSE
RFAREVLGRAHATGEVDDSKFNVLGGSIAYGHPFAATGARMITQTLHELHRRGGGFGLVT
ACAAGGLGAAMVLEAE

MD5 = 3ba3831c48364d2aca5d98f3e4d37b1c


  DNA Sequence

>fig|1116050.3.peg.2610 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)
atgggtcaggttttaccgctggttacccgccagggcgatcgtatcgccattgttagcggt
ttacgtacgccttttgcccgccaggggacggcttttcatggcattcccgcggttgattta
gggaagatggtggtaggcgaactgctggcacgcagcgagatccccgctgaagtgattgaa
cagctggtctttggtcaggtcgtacaaatgcctgaagcccccaacattgcgcgtgaaatt
gttctcggtaccggaatgaatgtgcataccgatgcttacagcgtcagccgcgcttgcgct
accagtttccaggcggttgcaaacgtcgcagaaagcctgatggcgggaactatccgagcg
gggattgccggtggggcagattcctcttccgtattgccaattggcgtcagtaaaaaactg
gcgcgcgtgctggttgatgtcaacaaagctcgaaccatgagccagcgcctgaaactcttc
tctcgcctgcgtttgcgcgacttaatgcccgtaccgcctgcggtagcagaatattctact
ggcttgcggatgggcgacaccgccgaacaaatggcgaaaacctacggcatcacccgagaa
cagcaagatgcattagcgcaccgttcgcatcagcgtgccgctcaggcatggtcagacgga
aaactcaaagaagaggtgatgactgcctttatccctccttataaacaaccgcttgtcgaa
gacaacaatattcgcggtaattcctcgcttgccgattacgcaaagctgcgtccggcgttt
gatcgtaaacacggaacggtaacggcggcaaacagtacgccgctgaccgatggcgcggca
gcggggatcctgatgactgaatcccgagcgaaagaattagggctggtgccgctggggtat
ctgcgcagctacgcatttactgcgattgatgtctggcaggacatgttgctcggtccggcc
tggtcaacaccgctggcgctggagcgtgccggtttgacgatgagcgatctgacattgatc
gatatgcacgaagcctttgccgctcagacactggcgaatattcagttgctgggcagcgaa
cgttttgctcgtgaagtactggggcgtgcacatgccactggcgaagtggacgatagcaaa
tttaacgtgcttggcggttcgattgcttacgggcatcccttcgcggcgaccggcgcgcgg
atgattacccagacattgcatgaacttcaccgtcgcggcggtggatttggtttagttacc
gcctgtgctgccggtgggcttggcgcggcaatggttctggaggcggaataa


  DNA with Flanking Sequence

>fig|1116050.3.peg.2610 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)
ctggcaccttgggtgcacatacagaggaaatcaacgatgagtaaatgtagtgctgatgaa
accccggtttgctgctgtatggatgttggcaccattatggacaactccgactgcaccgcg
tcttacagccgcgtgtttgcaaaccgcgcagaagcagaacaaacgctggcggcgctgact
gaaaaagcccgtagcgtggaatccgaaccgtgcaaaatctccccgactttcactgaagag
tctgacggtgtgcgcctggatatcgatttcacttttgcctgcgaagctgaaatgctgatc
ttccagctgggtctgcgttaattcctctcgggtacgttcgcccctgtcagttgctggcag
gggcgttttcttttctttctcctgtcttcactgtgtcatagctcccactttcttttttct
ccgcttggctaaatgtaaaaaaatggttaagactatgatcaggtcagaccactttattta
tttttttacaggggagtgttatgggtcaggttttaccgctggttacccgccagggcgatc
gtatcgccattgttagcggtttacgtacgccttttgcccgccaggggacggcttttcatg
gcattcccgcggttgatttagggaagatggtggtaggcgaactgctggcacgcagcgaga
tccccgctgaagtgattgaacagctggtctttggtcaggtcgtacaaatgcctgaagccc
ccaacattgcgcgtgaaattgttctcggtaccggaatgaatgtgcataccgatgcttaca
gcgtcagccgcgcttgcgctaccagtttccaggcggttgcaaacgtcgcagaaagcctga
tggcgggaactatccgagcggggattgccggtggggcagattcctcttccgtattgccaa
ttggcgtcagtaaaaaactggcgcgcgtgctggttgatgtcaacaaagctcgaaccatga
gccagcgcctgaaactcttctctcgcctgcgtttgcgcgacttaatgcccgtaccgcctg
cggtagcagaatattctactggcttgcggatgggcgacaccgccgaacaaatggcgaaaa
cctacggcatcacccgagaacagcaagatgcattagcgcaccgttcgcatcagcgtgccg
ctcaggcatggtcagacggaaaactcaaagaagaggtgatgactgcctttatccctcctt
ataaacaaccgcttgtcgaagacaacaatattcgcggtaattcctcgcttgccgattacg
caaagctgcgtccggcgtttgatcgtaaacacggaacggtaacggcggcaaacagtacgc
cgctgaccgatggcgcggcagcggggatcctgatgactgaatcccgagcgaaagaattag
ggctggtgccgctggggtatctgcgcagctacgcatttactgcgattgatgtctggcagg
acatgttgctcggtccggcctggtcaacaccgctggcgctggagcgtgccggtttgacga
tgagcgatctgacattgatcgatatgcacgaagcctttgccgctcagacactggcgaata
ttcagttgctgggcagcgaacgttttgctcgtgaagtactggggcgtgcacatgccactg
gcgaagtggacgatagcaaatttaacgtgcttggcggttcgattgcttacgggcatccct
tcgcggcgaccggcgcgcggatgattacccagacattgcatgaacttcaccgtcgcggcg
gtggatttggtttagttaccgcctgtgctgccggtgggcttggcgcggcaatggttctgg
aggcggaataatggaaatgacatcagcgtttacccttaatgttcgtctggacaacattgc
cgttatcaccatcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctc
gcaggtgcgcgccattattaagcaactccgtgaaaacaaagagttgcgaggcgtggtgtt
tgtctccgctaaaccggacaacttcattgctggcgcagacatcaacatgatcggcaactg
caaaacggcgcaagaagcggaagcactggcgcggcagggccaacagttgatggcggagat
tcatgctttgcccattccggttatcgcggctattcatggcgcttgcctgggcggtgggct
ggagctggcgctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcgg
tttgcctgaagtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcg
tctgataggcgtcagtacagcattagagatg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search