The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116007.3.peg.4699: Escherichia coli 2731150

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116007

Current Assignment: Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11)
Translate Function Assignments



Context on contig AQEB01000175 from base 25368 to 38517 (13150 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4694 26261 25368 894 -           HTH-type transcriptional regulator IlvY locus|EC2731150_4378, protein_id|EMW72992.1, gi|476254225
4695 26411 27886 1476 + 149     2: 2 6 dlit(2653423)
dlit(15654896)
dlit(9015391)
Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|EC2731150_4379, protein_id|EMW72993.1, gi|476254226
4696 28254 27973 282 - 86       dlit(8163020) Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) gene_name|ppiC, locus|EC2731150_4380, protein_id|EMW72994.1, gi|476254227
4697 28902 28453 450 - 198         FIG00642180: hypothetical protein locus|EC2731150_4381, protein_id|EMW72995.1, gi|476254228
4698 29119 31140 2022 + 216         ATP-dependent DNA helicase Rep gene_name|rep, locus|EC2731150_4382, protein_id|EMW72996.1, gi|476254229
4699 32671 31187 1485 - 46         Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11) locus|EC2731150_4383, protein_id|EMW72997.1, gi|476254230
4700 34070 32805 1266 - 133       dlit(8610017)
dlit(12181321)
ATP-dependent RNA helicase RhlB (EC 3.6.4.13) gene_name|rhlB, locus|EC2731150_4384, protein_id|EMW72998.1, gi|476254231
4701 34201 34530 330 + 130     2: 3 5 dlit(1094461)
dlit(2181145)
dlit(6098320)
dlit(1561103)
dlit(4883076)
dlit(6099324)
dlit(3891733)
Thioredoxin locus|EC2731150_4385, protein_id|EMW72999.1, gi|476254232
4702 34857 36116 1260 + 326       dlit(7828920)
dlit(10230401)
dlit(6304634)
dlit(9586995)
dlit(8466900)
Transcription termination factor Rho gene_name|rho, locus|EC2731150_4387, protein_id|EMW73001.1, gi|476254234
4703 36126 36344 219 + 9         Putative phosphotransferase enzyme IIB component SgcB locus|EC2731150_4388, protein_id|EMW73002.1, gi|476254235
4704 36356 37459 1104 + 11     2: 4 1   Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-) gene_name|wecA, locus|EC2731150_4389, protein_id|EMW73003.1, gi|476254236
4705 37471 38517 1047 + 11         regulator of length of O-antigen component of lipopolysaccharide chains gene_name|wzzE, locus|EC2731150_4390, protein_id|EMW73004.1, gi|476254237

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116007.3.peg.4699 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11)
MGSTSSLYAAIDLGSNSFHMLVVREVAGSIQTLTRIKRKVRLAAGLNSENALSNEAMERG
WQCLRLFAERLQDIPPSQIRVVATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLI
YQGVAHTTGGADQRLVVDIGGASTELVTGTGAQTTSLFSLSMGCVTWLERYFADRNLGQE
NFDAAEKAAREVLRPVADELRYHGWKVCVGASGTVQALQEIMMAQGMDERITLEKLQQLK
QRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQCMTLAGGALREGLVYGML
HLAVEQDIRSRTLRNIQRRFMIDIDQAQRVAKVAANFFDQVEKEWHLEAISRDLLISACQ
LHEIGLSVDFKQAPQHAAYLVRNLDLPGFTPAQKKLLATLLLNQTNPVDLSSLHQQNAVP
PRVAEQLCRLLRLAIIFASRRRDDLVPEMTLQANHELLTLTLPQGWLTQHPLGKEIIAQE
SQWQSYVHWPLEVH

MD5 = 70d481cfd6971ff465c4f1c12852f1f5


  DNA Sequence

>fig|1116007.3.peg.4699 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11)
atgggttccacctcgtcgctgtatgcagccattgatctcggttcgaatagttttcatatg
ctggttgtgcgcgaggtggctggaagcatccagacgctgacgcgaataaaacgcaaagtg
cgtctggctgctggcctgaatagcgaaaatgccctgtctaatgaagcaatggagcgcggt
tggcaatgtctgcgcctgtttgctgaacgtctgcaagatatccctccctcgcaaattcgc
gttgtcgctacggcgacattacgtcttgccgtcaatgcgggtgattttattgccaaagcg
caggaaatcctcggttgtccggtacaggtgatcagcggtgaagaggaagcacgtctgatt
tatcagggcgttgctcacacaactggcggtgccgatcagcgcctggtggtggatataggc
ggtgccagtactgaactggtaaccggcacgggtgcacaaaccacctcgttgttcagcctg
tcgatgggctgcgtcacctggctggaacgctattttgccgatcgtaatctggggcaggaa
aattttgatgctgcagaaaaagcggcacgcgaagtgttacgtccggttgccgatgaatta
cggtatcacggctggaaagtgtgcgttggtgcttccggcaccgtgcaggcgttacaggaa
atcatgatggcacaggggatggatgaacgcattaccctggaaaagttgcagcaattgaaa
cagcgagccattcattgcggtcggctggaggaactggagattgacgggctgacgctggaa
cgtgcgttagtgttcccgagtggtctggcgatcctgatcgccatttttaccgaactgaat
attcagtgtatgaccctggcgggcggtgcgctgcgtgaaggcctggtctacggcatgttg
catctggccgtcgagcaggatattcgcagccgtacgctgcgtaatattcagcgccgcttt
atgatcgatattgatcaggcgcagcgcgtagccaaagttgcggctaacttcttcgatcag
gtggaaaaggaatggcatcttgaagcaataagccgcgatttgctcatcagcgcctgtcag
cttcatgaaatcggcctgagcgttgactttaaacaagcgccgcaacacgctgcttatctg
gtgcgtaatctggatcttcccggttttacccccgcacagaaaaaattgctggcgacgcta
ctgctcaaccagactaatccggtcgatctctcatcgctgcatcagcaaaatgccgtaccg
ccgcgcgtcgcagaacaactctgccgtttactccgcctggccatcatttttgccagccgt
cgccgtgacgatctcgtgccagagatgacattacaggctaaccatgaactgttgaccttg
acgcttccgcaaggttggctaacccaacatccgctgggtaaagagattattgctcaggaa
agccagtggcagagctatgtccactggccgctggaagtgcattaa


  DNA with Flanking Sequence

>fig|1116007.3.peg.4699 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11)
tgaatttacccgtggcgatctggatattctggttgccaccgacgttgccgcgcgtggttt
gcatattccggcagtgacgcacgtctttaactacgatttacccgatgactgtgaagatta
cgttcaccgtattggtcgtacaggtcgcgcaggcgcaagcggtcactctatcagcctggc
gtgtgaagagtatgcattgaatttgcctgctattgagacctatattggtcactcaattcc
ggtaagcaaatacaatccggacgcattgatgaccgatctgccaaaaccgctgcgcctcac
gcgcccacgtacaggcaatggtccgcgtcgtactggcgctccgcgtaatcgtcgtcgttc
aggttaaataaaatgtcatactcaaaatcattcaaactgtatcaagatggcaagagaatg
aatcccgatgagcatactgtagtaagtgattcaggtgaaagaatgcagccaacacagaga
cagattgaaggatgaagagtatgggttccacctcgtcgctgtatgcagccattgatctcg
gttcgaatagttttcatatgctggttgtgcgcgaggtggctggaagcatccagacgctga
cgcgaataaaacgcaaagtgcgtctggctgctggcctgaatagcgaaaatgccctgtcta
atgaagcaatggagcgcggttggcaatgtctgcgcctgtttgctgaacgtctgcaagata
tccctccctcgcaaattcgcgttgtcgctacggcgacattacgtcttgccgtcaatgcgg
gtgattttattgccaaagcgcaggaaatcctcggttgtccggtacaggtgatcagcggtg
aagaggaagcacgtctgatttatcagggcgttgctcacacaactggcggtgccgatcagc
gcctggtggtggatataggcggtgccagtactgaactggtaaccggcacgggtgcacaaa
ccacctcgttgttcagcctgtcgatgggctgcgtcacctggctggaacgctattttgccg
atcgtaatctggggcaggaaaattttgatgctgcagaaaaagcggcacgcgaagtgttac
gtccggttgccgatgaattacggtatcacggctggaaagtgtgcgttggtgcttccggca
ccgtgcaggcgttacaggaaatcatgatggcacaggggatggatgaacgcattaccctgg
aaaagttgcagcaattgaaacagcgagccattcattgcggtcggctggaggaactggaga
ttgacgggctgacgctggaacgtgcgttagtgttcccgagtggtctggcgatcctgatcg
ccatttttaccgaactgaatattcagtgtatgaccctggcgggcggtgcgctgcgtgaag
gcctggtctacggcatgttgcatctggccgtcgagcaggatattcgcagccgtacgctgc
gtaatattcagcgccgctttatgatcgatattgatcaggcgcagcgcgtagccaaagttg
cggctaacttcttcgatcaggtggaaaaggaatggcatcttgaagcaataagccgcgatt
tgctcatcagcgcctgtcagcttcatgaaatcggcctgagcgttgactttaaacaagcgc
cgcaacacgctgcttatctggtgcgtaatctggatcttcccggttttacccccgcacaga
aaaaattgctggcgacgctactgctcaaccagactaatccggtcgatctctcatcgctgc
atcagcaaaatgccgtaccgccgcgcgtcgcagaacaactctgccgtttactccgcctgg
ccatcatttttgccagccgtcgccgtgacgatctcgtgccagagatgacattacaggcta
accatgaactgttgaccttgacgcttccgcaaggttggctaacccaacatccgctgggta
aagagattattgctcaggaaagccagtggcagagctatgtccactggccgctggaagtgc
attaatgagtaagtgccggatgcgatgctgacgcatcttttccggccttgattatttccc
tcgttttgccgccatcatcgctttcagattcgccagatggctttgccctttctgcatccg
ttcttcggcgctgaccactttgcgctcctgttcccaaatcagatcatcctgcggcagctc
cagcaaaaagcggctcggctccgggcgcaccagctcgccgtactgacggcgttctttaca
cagcgtaaaggtcaattccttctgggcgcgggtaatgccgacataggccagccgccgctc
ctcatcgatattatcttcatcgatgctgctctggtgcggcaaaaatccttcttccatacc
gaccatgtagacataaggaaactccagcccttttgacgcgtgcagagtcatcagttgcac
ctgatccagctcttcttcactctcaccacgctccatcatgtcgcgcaaagtaaagcgcgt
caccacctgggtgagcgtcatcggc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search