The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116007.3.peg.4695: Escherichia coli 2731150

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116007

Current Assignment: Ketol-acid reductoisomerase (EC 1.1.1.86)
Translate Function Assignments



Context on contig AQEB01000175 from base 20925 to 34070 (13146 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4691 20925 21854 930 +       2: 3 1 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|EC2731150_4375, protein_id|EMW72989.1, gi|476254222
4692 21919 23769 1851 + 64     1: 1 dlit(3550695)
dlit(8325851)
dlit(13727223)
Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|EC2731150_4376, protein_id|EMW72990.1, gi|476254223
4693 23772 25316 1545 + 2     1: 1 dlit(240428) Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|EC2731150_4377, protein_id|EMW72991.1, gi|476254224
4694 26261 25368 894 - 51         HTH-type transcriptional regulator IlvY locus|EC2731150_4378, protein_id|EMW72992.1, gi|476254225
4695 26411 27886 1476 + 149     2: 1 2 dlit(2653423)
dlit(15654896)
dlit(9015391)
Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|EC2731150_4379, protein_id|EMW72993.1, gi|476254226
4696 28254 27973 282 - 86       dlit(8163020) Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) gene_name|ppiC, locus|EC2731150_4380, protein_id|EMW72994.1, gi|476254227
4697 28902 28453 450 - 198         FIG00642180: hypothetical protein locus|EC2731150_4381, protein_id|EMW72995.1, gi|476254228
4698 29119 31140 2022 + 216         ATP-dependent DNA helicase Rep gene_name|rep, locus|EC2731150_4382, protein_id|EMW72996.1, gi|476254229
4699 32671 31187 1485 - 46         Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11) locus|EC2731150_4383, protein_id|EMW72997.1, gi|476254230
4700 34070 32805 1266 - 133       dlit(8610017)
dlit(12181321)
ATP-dependent RNA helicase RhlB (EC 3.6.4.13) gene_name|rhlB, locus|EC2731150_4384, protein_id|EMW72998.1, gi|476254231

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CoA_Test Ketol-acid reductoisomerase (EC 1.1.1.86)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Ketol-acid reductoisomerase (EC 1.1.1.86)


  Protein Sequence

>fig|1116007.3.peg.4695 Ketol-acid reductoisomerase (EC 1.1.1.86)
MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDSG
LDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVINLTPDKQHSDVVRTVQP
LMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLF
QKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVL
MIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNGQLRDVNEAIRSHAIEQVGKKLRGY
MTDMKRIAVAG

MD5 = c9a3ff3d57da59c58e00846dfb3dcc5c


  DNA Sequence

>fig|1116007.3.peg.4695 Ketol-acid reductoisomerase (EC 1.1.1.86)
atggctaactacttcaatacactgaatctgcgccagcagctggcacagctgggcaaatgt
cgctttatgggccgcgatgaattcgccgatggcgcgagctaccttcagggtaaaaaagta
gtcatcgtcggctgtggcgcacagggtctgaaccagggcctgaacatgcgtgattctggt
ctcgatatctcctacgctctgcgtaaagaagcgattgccgagaagcgcgcgtcctggcgt
aaagcgaccgaaaatggttttaaagtgggtacttacgaagaactgatcccacaggcggat
ctggtgattaacctgacgccggacaagcagcactctgatgtagtgcgcaccgtacagcca
ctgatgaaagacggcgcggcgctgggctactcgcacggtttcaacatcgtcgaagtgggc
gagcagatccgtaaagatatcaccgtagtgatggttgcgccgaaatgcccaggcaccgaa
gtgcgtgaagagtacaaacgtgggttcggcgtaccgacgctgattgccgttcacccggaa
aacgatccgaaaggcgaaggcatggcgattgccaaagcctgggcggctgcaaccggtggt
caccgtgcgggtgtgctggaatcgtccttcgttgcggaagtgaaatctgacctgatgggc
gagcaaaccatcctgtgcggtatgttgcaggctggctctctgctgtgcttcgacaagctg
gtggaagaaggtaccgatccagcatacgcagaaaaactgattcagttcggttgggaaacc
atcaccgaagcactgaaacagggcggcatcaccctgatgatggaccgtctctctaacccg
gcgaaactgcgtgcttatgcgctttctgaacagctgaaagagatcatggcacccctgttc
cagaaacatatggacgacatcatctccggcgaattctcttccggtatgatggcggactgg
gccaacgatgataagaaactgctgacctggcgtgaagagaccggcaaaaccgcgtttgaa
accgcgccgcagtatgaaggcaaaatcggcgagcaggagtacttcgataaaggcgtactg
atgatcgcgatggtgaaagcgggcgttgaactggcgttcgaaaccatggtcgattccggc
atcattgaagagtctgcatattatgaatcactgcacgagctgccgctgattgccaacacc
atcgcccgtaagcgtctgtacgaaatgaacgtggttatctctgataccgctgagtacggt
aactatctgttctcttacgcttgtgtgccgttgctgaaaccgtttatggcagagctgcaa
ccgggcgacctgggtaaagctattccggaaggcgcggtagataacgggcaactgcgtgat
gtgaacgaagcgattcgcagccatgcgattgagcaggtaggtaagaaactgcgcggctat
atgacagatatgaaacgtattgctgttgcgggttaa


  DNA with Flanking Sequence

>fig|1116007.3.peg.4695 Ketol-acid reductoisomerase (EC 1.1.1.86)
gtgttccgcgcggaagcgatccagaatcggcggcagatggctgtaggcagcggtcaccga
gcagaagatatgtaattcgccagagagcgacggcccttgctgatcgatggtgtggcgcaa
ctgctgatactgcaacagcgtttgctgggagaaaacgcgcagctcttcgcccgcttcagt
cagcgtcaccgtgcggttatcgcgcacaaacagcggctgaccgagatcttcttccaggcg
ctgaatctgccgtgagagcgtggatgggctaacgtgcatcgcccgcgcgctgcggccaaa
atggcggctttccgccagatgcaggaaggttttcagatcgcgtaaatccacagggacagc
cctcgatgttgacgttgcaaaaattgcaatgtgacgttgtgaatatatcaatttccgcaa
taaatttcctgtcatatagtgaattcaatctcgcaaacgcgaaccgaacaataagaagca
caacatcacgaggaatcaccatggctaactacttcaatacactgaatctgcgccagcagc
tggcacagctgggcaaatgtcgctttatgggccgcgatgaattcgccgatggcgcgagct
accttcagggtaaaaaagtagtcatcgtcggctgtggcgcacagggtctgaaccagggcc
tgaacatgcgtgattctggtctcgatatctcctacgctctgcgtaaagaagcgattgccg
agaagcgcgcgtcctggcgtaaagcgaccgaaaatggttttaaagtgggtacttacgaag
aactgatcccacaggcggatctggtgattaacctgacgccggacaagcagcactctgatg
tagtgcgcaccgtacagccactgatgaaagacggcgcggcgctgggctactcgcacggtt
tcaacatcgtcgaagtgggcgagcagatccgtaaagatatcaccgtagtgatggttgcgc
cgaaatgcccaggcaccgaagtgcgtgaagagtacaaacgtgggttcggcgtaccgacgc
tgattgccgttcacccggaaaacgatccgaaaggcgaaggcatggcgattgccaaagcct
gggcggctgcaaccggtggtcaccgtgcgggtgtgctggaatcgtccttcgttgcggaag
tgaaatctgacctgatgggcgagcaaaccatcctgtgcggtatgttgcaggctggctctc
tgctgtgcttcgacaagctggtggaagaaggtaccgatccagcatacgcagaaaaactga
ttcagttcggttgggaaaccatcaccgaagcactgaaacagggcggcatcaccctgatga
tggaccgtctctctaacccggcgaaactgcgtgcttatgcgctttctgaacagctgaaag
agatcatggcacccctgttccagaaacatatggacgacatcatctccggcgaattctctt
ccggtatgatggcggactgggccaacgatgataagaaactgctgacctggcgtgaagaga
ccggcaaaaccgcgtttgaaaccgcgccgcagtatgaaggcaaaatcggcgagcaggagt
acttcgataaaggcgtactgatgatcgcgatggtgaaagcgggcgttgaactggcgttcg
aaaccatggtcgattccggcatcattgaagagtctgcatattatgaatcactgcacgagc
tgccgctgattgccaacaccatcgcccgtaagcgtctgtacgaaatgaacgtggttatct
ctgataccgctgagtacggtaactatctgttctcttacgcttgtgtgccgttgctgaaac
cgtttatggcagagctgcaaccgggcgacctgggtaaagctattccggaaggcgcggtag
ataacgggcaactgcgtgatgtgaacgaagcgattcgcagccatgcgattgagcaggtag
gtaagaaactgcgcggctatatgacagatatgaaacgtattgctgttgcgggttaagtgc
gcgctgatgccctcaccccgaccctctcccacagggagagggagaaaacactcaaggcct
tctcctggagaaggccttgctattagttgcggtacagcaccttaatgatgtgatatccga
actgggtgtgcagcgggccggtcggctccagtaccggacaagagaaaaccactttatcga
acgccggaaccatctgaccctggcggaattcacctaaatcaccgccgcgtttgcctgatg
ggcaaatggagtgtttcttcgccagcttgccgaaatcggcaccgttcttaatctgctcga
gaagatccagagccagtttctcttcttttacaaggatatgcagtgctgctgctgtttttg
ccatgatcgtgccttgagtgaataattgtcaggcggcgattttagcatgatccgcagatg
ctaacgtaattgtcagtcagggaggggctggtacatatatggcaaaagcccggaaaatcc
gggcttcgcaggtccc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(15654896);gjo
evidence_code dlit(2653423);gjo
evidence_code dlit(9015391);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search