The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116007.3.peg.4686: Escherichia coli 2731150

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116007

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig AQEB01000175 from base 11005 to 21854 (10850 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4676 11535 11005 531 -           Putative activator of ProP osmoprotectant transporter locus|EC2731150_4359, protein_id|EMW72973.1, gi|476254206
4677 11997 11572 426 - 36         Putative single stranded DNA-binding protein of prophage locus|EC2731150_4360, protein_id|EMW72974.1, gi|476254207
4678 12173 11994 180 - -4         FIG00638168: hypothetical protein locus|EC2731150_4361, protein_id|EMW72975.1, gi|476254208
4679 14341 12527 1815 - 353         DNA primase (EC 2.7.7.-), phage-associated locus|EC2731150_4362, protein_id|EMW72976.1, gi|476254209
4680 14625 14338 288 - -4         FIG00638501: hypothetical protein locus|EC2731150_4363, protein_id|EMW72977.1, gi|476254210
4681 14858 14631 228 - 5         FIG00639856: hypothetical protein locus|EC2731150_4364, protein_id|EMW72978.1, gi|476254211
4682 15087 14851 237 - -8         hypothetical protein locus|EC2731150_4365, protein_id|EMW72979.1, gi|476254212
4683 15283 15077 207 - -11         FIG00639870: hypothetical protein locus|EC2731150_4366, protein_id|EMW72980.1, gi|476254213
4684 16203 15316 888 - 32         FIG00639870: hypothetical protein locus|EC2731150_4367, protein_id|EMW72981.1, gi|476254214
4685 16444 16256 189 - 52         COG3311: Predicted transcriptional regulator locus|EC2731150_4368, protein_id|EMW72982.1, gi|476254215
4686 16524 16649 126 + 79         hypothetical protein locus|EC2731150_4369, protein_id|EMW72983.1, gi|476254216
4687 18050 16821 1230 - 171         Mobile element protein locus|EC2731150_4371, protein_id|EMW72985.1, gi|476254218
4688 18408 18229 180 - 178         MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein locus|EC2731150_4372, protein_id|EMW72986.1, gi|476254219
4689 18999 20645 1647 + 590     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|EC2731150_4373, protein_id|EMW72987.1, gi|476254220
4690 20642 20905 264 + -4     1: 1 dlit(3550695) Acetolactate synthase small subunit (EC 2.2.1.6) gene_name|ilvM, locus|EC2731150_4374, protein_id|EMW72988.1, gi|476254221
4691 20925 21854 930 + 19     2: 2 1 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|EC2731150_4375, protein_id|EMW72989.1, gi|476254222

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116007.3.peg.4686 hypothetical protein
MEWQTVMWCSSLKQAQLEKNYFDSFGYKGVKFCIYAFFTYF

MD5 = 7b4af3aed2d1c53e4d976a71c335433f


  DNA Sequence

>fig|1116007.3.peg.4686 hypothetical protein
atggaatggcaaacagtgatgtggtgttcgtcgctgaaacaggcgcaattagaaaaaaac
tattttgattcatttggatacaaaggcgtaaaattctgcatttacgccttttttacatat
ttttaa


  DNA with Flanking Sequence

>fig|1116007.3.peg.4686 hypothetical protein
acggttgatataattcccctgcactgatccatttttttcgcagcaggttaattgttcaga
aaggcggttccttatcggggccgctttttttatgcctgaaaatacccgataacatggctt
tttagtttcaccaggacgaacgaagccccgcccctgttcgggcgtatatccagtattcat
ggttagatctctgtgttagtggatgggtggcggcggtgcgccgccagcctgattagtgaa
ctgcctcgcggctgtccttccatgccagaacttcggataaagaccagccaacggaacgac
cgccgagtttacgccgtgatgggaattgtccggtcttttccaggcgataccgacatgagc
ggctcaggcctgtaagttgctgacattctttttcacgtataaagcgatctgtgcttaaca
caattccccctttgttgtttcttaaagagtcattgggtggattattgggttgggttgtgt
cggattgtgtcagggtgtttatggaatggcaaacagtgatgtggtgttcgtcgctgaaac
aggcgcaattagaaaaaaactattttgattcatttggatacaaaggcgtaaaattctgca
tttacgccttttttacatatttttaagattgattcgccaatgtacaaaaaaacagtaaac
caccagaaaatcagacttatagggagttaatcagaaataatcatagataatcagatttgt
tccagattgtttgccgttgttcgtcgttgtgtctcgttgttccacgttgtgtccgttctg
aaaaatcacgaaaaaaattatatttctctggctattggcagtgtggttacgttttcgtga
gtacccgccagtatctctaaccgctctgtccacatgtccagcgcattacgtttcgcatcg
agataacgggagtggttatagactcgctgcatccctggcatctggtgagcggtgagttgt
tcgacaatatgcggatccacgcctaaatcgttcagcatcgtggtaaacgtgcgccgtata
tcgtgtagtgaccagtgcggatggtttaattttttgtgcgtgaatctgccgtattgcgac
acgctggcttcctgtttcagttccccgagtaatagtcctgtgtgtc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search