The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1074482.3.peg.371: Bifidobacterium breve DPC 6330

This feature in The SEED Viewer

NCBI Taxonomy Id: 1074482

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig AFXX01000010 from base 43441 to 54323 (10883 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
359 43441 43944 504 +           hypothetical protein  
360 43941 44138 198 + -4         hypothetical protein  
361 44135 44416 282 + -4         hypothetical protein  
362 44413 44742 330 + -4         hypothetical protein  
363 44739 44915 177 + -4         hypothetical protein  
364 45423 46229 807 + 507         hypothetical protein  
365 46214 46447 234 + -16         hypothetical protein  
366 46444 46620 177 + -4         hypothetical protein  
367 46623 46934 312 + 2         hypothetical protein  
368 46931 47158 228 + -4         hypothetical protein  
369 47155 47298 144 + -4         hypothetical protein  
370 47637 48044 408 + 338         hypothetical protein  
371 48590 48853 264 + 545         hypothetical protein  
372 48946 49308 363 + 92         hypothetical protein  
373 49322 50935 1614 + 13         gp2, terminase  
374 50957 52363 1407 + 21         hypothetical protein  
375 52360 53106 747 + -4         Putative prohead protease  
376 53121 54323 1203 + 14         Phage major capsid protein #Fam0024  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1074482.3.peg.371 hypothetical protein
MPQQPVTLELIATISDKTFPIGSFTVNIPINVTHNEVNTYKVGATYTTLIRPKPPSTDEL
ITRFTNAIKAFKTAFETNPDEVGAVKS

MD5 = a13cdb863393b09d87bfb4cab9483cb7


  DNA Sequence

>fig|1074482.3.peg.371 hypothetical protein
atgccacagcagccagtcacactagagctcatcgccacaatcagtgacaagacattccca
atcggctcattcaccgtcaacatcccgatcaacgtcacccacaacgaagtcaacacctac
aaagtcggagccacatacaccacactcatcagacccaagccaccaagcacagacgaactc
atcacacgattcacaaacgcaatcaaagcattcaaaacagcattcgaaaccaaccccgac
gaggtaggggcggtgaaatcctga


  DNA with Flanking Sequence

>fig|1074482.3.peg.371 hypothetical protein
gttggaccattattcatatccagcttcgatagctcaacagcagagcaggcggaatagcgc
aaataccaacggtcggaccccaaccaaccatggcaccacaccgcacacaaccatgatgac
aacaacgcattccacccacgccggtccgactccggcacgaagcaccaaggcggtgaccac
atgccaagagtccgcaagaccacacgccaattcgaaaaagacaaggccgcattcttcaac
caatgcaaagcacggcatgcggtctgttggctctgcggaatgccaatcgactacaccgcc
gaaaagaacacgagcgacgaatcatacaatcttgaccacctctacccagtcagcaaacac
gccgaactccagttcgacccagcaggcttccgcccaagccacaccagctgcgatagactc
cgaggcaaccaagacccaccaacaccaatcggaacactctcaagacaatggataacaaca
gcatgagcaaggaggcaatgatgccacagcagccagtcacactagagctcatcgccacaa
tcagtgacaagacattcccaatcggctcattcaccgtcaacatcccgatcaacgtcaccc
acaacgaagtcaacacctacaaagtcggagccacatacaccacactcatcagacccaagc
caccaagcacagacgaactcatcacacgattcacaaacgcaatcaaagcattcaaaacag
cattcgaaaccaaccccgacgaggtaggggcggtgaaatcctgaaaacagagcaaccacg
caacactgcccgcgtggttgctcttcctctccccgatgatgttttttgttgatgggtcgc
gcgtgaaggaggctttatggcagttaagaagggtgtttccgagcgtcgtttcccgcatga
gtccgtggctgatgcgttggagaggtctttgcgtaatgcgaagtcgttgcgtgccgagaa
tgcggctgtcgtggccgctgcgcgtatccttgccaaccggattgattcgatttgcgagac
tggtttcattgacgagaacgggaaattggacaatgtgtcggttccgacgtttttgaaata
ctgccagtcgcttggtttgacggtggatgttccggctaaggttggtcggcctgcgaagcc
gaaggccgaggcgaagcaggagaagccgaagagcgacaaggttgtgcagatggcggattt
catgaagcgtttcggctaggaggcggtgtctgatggcggcggagaatctcacggttttcg
gtgc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search