The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1074482.3.peg.362: Bifidobacterium breve DPC 6330

This feature in The SEED Viewer

NCBI Taxonomy Id: 1074482

Current Assignment: hypothetical protein
Turn Off Function Translation



Context on contig AFXX01000010 from base 39244 to 50935 (11692 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
350 39244 39465 222 +           hypothetical protein  
351 39637 40284 648 + 171         hypothetical protein  
352 40281 40439 159 + -4         hypothetical protein  
353 40436 41398 963 + -4         hypothetical protein  
354 41401 42246 846 + 2         Recombinational DNA repair protein RecT (prophage associated)  
355 42246 42416 171 + -1         hypothetical protein  
356 42416 42916 501 + -1         Single-stranded DNA-binding protein  
357 42916 43059 144 + -1         hypothetical protein  
358 43046 43438 393 + -14         hypothetical protein  
359 43441 43944 504 + 2         hypothetical protein  
360 43941 44138 198 + -4         hypothetical protein  
361 44135 44416 282 + -4         hypothetical protein  
362 44413 44742 330 + -4         hypothetical protein  
363 44739 44915 177 + -4         hypothetical protein  
364 45423 46229 807 + 507         hypothetical protein  
365 46214 46447 234 + -16         hypothetical protein  
366 46444 46620 177 + -4         hypothetical protein  
367 46623 46934 312 + 2         hypothetical protein  
368 46931 47158 228 + -4         hypothetical protein  
369 47155 47298 144 + -4         hypothetical protein  
370 47637 48044 408 + 338         hypothetical protein  
371 48590 48853 264 + 545         hypothetical protein  
372 48946 49308 363 + 92         hypothetical protein  
373 49322 50935 1614 + 13         gp2, terminase  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1074482.3.peg.362 hypothetical protein
MSIADDEAEKAYPTRHWDGTHVKEQFCCDTDDLQEAYLRGRNAPPTNAEIEAVAKRLCYL
SQPPLWFPTEPPAEQEKNLWRNMGMCDAQDEWLDKARDLLETARKAVNE

MD5 = 4143678832e4a970654b80e265446b80


  DNA Sequence

>fig|1074482.3.peg.362 hypothetical protein
atgagtatcgcggatgatgaagctgagaaggcgtatccgacccgccactgggatggaacg
catgtcaaggaacagttttgctgcgacacggacgatttgcaggaagcatacctgcgcggt
cgcaacgcgccacccacgaatgccgagatagaggccgtggcgaaaagactgtgctacctc
tcacaaccgccactctggttcccgaccgagccgccagccgaacaagagaagaacctatgg
cggaacatgggcatgtgcgacgcgcaagacgaatggcttgacaaggcacgagacctgctc
gaaaccgcacggaaggcggtaaacgaatga


  DNA with Flanking Sequence

>fig|1074482.3.peg.362 hypothetical protein
aaaccaccaagcaaagcgaggacgcgaaatgacgattgacgaactgcatgattactgccg
ttacctcttcgacgagaaccatgtgcatggcgtgcctgacaagtggagcgaaggctacga
gttcgcgctcagccttgtcatgttcaagtgccatgagggattaacagacgaagaccgtca
gagaatcgccgactggcgtgaaaaacattggaaggacacgaaatgagcgcagcggaaacc
gatgaaaaaacactgcctatgactgatacgcactatgcagtcagcatcaggagaatctac
gacgcgcataccgacatgctcaaggggtacaagctgatcctctgggaaatgcaggaaaaa
gcccggatagctgtagcggcacgcgactatccgaccggaatgctcgaaccgataccgcaa
caaacgttggatgatgctgacacgttagcacgcatattccaatgcaagaactacaggaac
gacgaaacggagatgtgggaatgagtatcgcggatgatgaagctgagaaggcgtatccga
cccgccactgggatggaacgcatgtcaaggaacagttttgctgcgacacggacgatttgc
aggaagcatacctgcgcggtcgcaacgcgccacccacgaatgccgagatagaggccgtgg
cgaaaagactgtgctacctctcacaaccgccactctggttcccgaccgagccgccagccg
aacaagagaagaacctatggcggaacatgggcatgtgcgacgcgcaagacgaatggcttg
acaaggcacgagacctgctcgaaaccgcacggaaggcggtaaacgaatgagcaagacgat
caagtatgtggaatgcgcccactgcggcgagaccgtcggcacatattacgtgacatgccc
ctactgcgggtacaagctggccatgcgcaggccgacaactggcatggacccgctgtatgg
catgaccgacgacgaattctaccgagggctcgggagcatgtgatggccgaacaaggaagg
aaacgagactaaaaatgagcgatttcactggtgccggtggcgcagcttacatgtcaaacc
gcatgaattgggagactccacaggaattgtttgaccagctcgacgcggagtttcacttca
cgttagacgcggctagcagcgcaacgaaccacaagtgccagaaatactatacagccgaag
acagcgcatttgatcatgagtgggggggggagacggtattctgcaatcctccatacggca
aggcaatcgcggaatgggtgcgcaaatgcagcgcagaagccagccgcaaagacaccctcg
tcgtcatgct


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search