The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1074482.3.peg.341: Bifidobacterium breve DPC 6330

This feature in The SEED Viewer

NCBI Taxonomy Id: 1074482

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig AFXX01000010 from base 29051 to 40284 (11234 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
336 29051 30223 1173 +       2: 3 1   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)  
337 30326 31864 1539 + 102     5: 5 1 6 4 2   UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)  
338 31924 32898 975 + 59         Cell division protein FtsQ homolog  
339 34056 33568 489 - 669         hypothetical protein  
340 34589 34317 273 - 260         hypothetical protein  
341 35022 34897 126 - 307         hypothetical protein  
342 35128 35259 132 + 105         hypothetical protein  
343 35611 35330 282 - 70         hypothetical protein  
344 35809 35937 129 + 197         hypothetical protein  
345 36000 36173 174 + 62         hypothetical protein  
346 36539 36976 438 + 365         methyltransferase, putative  
347 36973 37182 210 + -4         hypothetical protein  
348 38188 38475 288 + 1005         type II DNA modification methyltransferase, putative  
349 38472 39251 780 + -4         Phage antirepressor protein  
350 39244 39465 222 + -8         hypothetical protein  
351 39637 40284 648 + 171         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1074482.3.peg.341 hypothetical protein
MYDDDLWSIADELNVTTQVLTDYRATLNTSPNRIKERFFNA

MD5 = 669f0bb7f9037485b610d9e656868f2a


  DNA Sequence

>fig|1074482.3.peg.341 hypothetical protein
atgtacgacgatgacctatggtcgatagccgatgaactcaacgtgaccacgcaggtgctc
acggactaccgagccacgctcaacacatcgccaaacagaatcaaagaaaggtttttcaat
gcgtaa


  DNA with Flanking Sequence

>fig|1074482.3.peg.341 hypothetical protein
agatctggaacgcatcagccaagtgacaggaatctctcctggcgatatcgtgatgaactc
tcagcgccatgcggtcgaagccaccgagaggaaagcgcaggcaggcggttatggtcttgc
cgcgtacagggaagacggcaagcaggaggctattaatggagaggctgggccggattacga
cgagcctgcctgacctgccgatagaccgccgtatgacctatggcgcgatgcgccgcgcga
tcgtcggcctgcccgtcaccatttcaagcgccctgctgccgaatggattgtggggctgct
acgacaatgaaaaccgcgtcatactgattgatcgacggctcacgtacacggccaaaaggt
gcgtgctcacgcatgagctgttgcactggcggcatggcgacgccggttgttcgaacgatc
gttcgaagcgggaacgacggacgagatggcagaccgcgcgcctgctcatcgacccggcag
aactagcattggcggaacgcatgtacgacgatgacctatggtcgatagccgatgaactca
acgtgaccacgcaggtgctcacggactaccgagccacgctcaacacatcgccaaacagaa
tcaaagaaaggtttttcaatgcgtaagaaaatcattgccatcacagcggcgacgcttctc
ctggcgacggcctgtggctgcggaagccagcaggagccggcccccacgacggccaagacg
ccggacgtcagcgcacagcaggagaagccacaacaacaggcagccgagaagacggcgcag
agctttgtggatgagttcaacgcgaactcctcgacaccgataaccgacgtcgagaaattc
acgccgagtgatgcgaacggcccctattatcggacggagtatcgcaccggcgctttctcc
gacgcggacgcgctccacggaaagctaggtcaattgtcggtggacgtattggtctatggc
gcagtgcttggatacggggagaacgatatgatccgcgtctacgtcgatgggccgcatgat
gagatcgacggcgtattccccatcatggcgaagacgcttgatccgtcgctctccgatcag
gacatccaaagtcagctggcgaaggagtatccgtccaatgatcttg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search