The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|101031.3.peg.3858: Bacillus B-14905

This feature in The SEED Viewer

NCBI Taxonomy Id: 101031

Current Assignment: Antirepressor [Bacteriophage A118]
Translate Function Assignments



Context on contig 101031_fragment_81 from base 30877 to 41881 (11005 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3852 31104 30877 228 -           Mobile element protein  
3853 31592 31164 429 - 59         transposase  
3854 31898 33319 1422 + 305         hypothetical protein  
3855 33532 34359 828 + 212     2: 2 1 ff
idu(4)
Peptidase, M23/M37 family  
3856 35485 34757 729 - 397         hypothetical protein  
3857 35651 35911 261 + 165         hypothetical protein  
3858 35927 36736 810 + 15         Antirepressor [Bacteriophage A118]  
3859 38122 37148 975 - 411         hypothetical protein  
3860 38665 38459 207 - 336         hypothetical protein  
3861 40001 39183 819 - 517         hypothetical protein  
3862 41651 40575 1077 - 573         hypothetical protein  
3863 41708 41881 174 + 56         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|101031.3.peg.3858 Antirepressor [Bacteriophage A118]
MNELKTFNHQMFGELPLIIVDGKEYFGATDVAKSLEYKQPEHAVKNHCDSEGCISYTVPT
DGGKQQKNFITLGNVSRLIVAASKQSKNPEIQQKAKVYEKWIFDEVIPSVHKQGGYIATT
DDDDDETIMAKALILAQKTIKKKQYEILEQQRIIEVQRPKVVYADAVEVSEDTVLVKDLA
TVLRQKGVNIGEVRLFKWLRENGYLCKQKGEMWNMPTQRSLELGVIVVKHGLRTGSNGEM
KKTRTPKITGKGQVYFINKILEEQGLLAM

MD5 = 9a4901771e36371af0476372d572ed78


  DNA Sequence

>fig|101031.3.peg.3858 Antirepressor [Bacteriophage A118]
atgaacgaactgaaaacatttaatcaccagatgtttggagaattaccattaatcattgtt
gatgggaaagaatacttcggtgctacagacgtagctaagtctttagaatataaacaacca
gaacatgccgttaaaaatcactgtgattccgaggggtgtataagttatacagtccctact
gacgggggtaaacaacagaaaaatttcatcacactaggaaatgtatctcggttaatagtt
gcagcttctaagcaaagtaagaatccagaaatacaacaaaaggcaaaagtatatgaaaag
tggatttttgatgaggttataccatctgttcataaacaaggtggctacatcgctactact
gatgatgatgatgatgaaacgattatggcaaaagctttgatattagctcagaaaacgatt
aaaaaaaagcaatatgaaatacttgaacaacaacggattattgaagtgcaaagacctaaa
gttgtatacgcagatgcagttgaagtatctgaggatacagtacttgtaaaagatttagca
acagttttaagacaaaaaggtgttaatattggtgaggttagattgtttaaatggttgcgt
gaaaatggctacctttgcaaacaaaaaggtgagatgtggaatatgcctactcaacgtagt
ttagaattaggtgtgattgttgtgaagcatgggcttcgaacaggaagcaatggtgaaatg
aagaaaactcgtactccgaaaattactggtaagggacaagtttactttataaataaaatt
ttagaagaacaagggttattggcaatgtaa


  DNA with Flanking Sequence

>fig|101031.3.peg.3858 Antirepressor [Bacteriophage A118]
tcatcaagagttaatctcgattgttctatataactttgtagtaattcggcgtatttcata
acatcaccatcctaacctttaattatgaattgttgttgtaaaaatagcaacaatatataa
gttgatatttctatgctaattatagttgcaataaaaagtttaagttgttattattaattt
aatagctttggtgctattaatttttatataaaggagagaccaaaatgacttattctgaat
tgctaaaattagctatagttaaatcgcggttatctcttagcgaaatatctggtgagctaa
gagaacttgggttttctgcggacaagacgtatttgagtaaactacaaaatggtagaatcc
caccagctagtaataaactcaatgaagcattagctgacattctaaatgtagatgctttgg
agttaaaagttgctgcttatcgagagaagataccaaaggacgttttagaaaaattgattt
cataaaaaggagagatgaatatgaacgaactgaaaacatttaatcaccagatgtttggag
aattaccattaatcattgttgatgggaaagaatacttcggtgctacagacgtagctaagt
ctttagaatataaacaaccagaacatgccgttaaaaatcactgtgattccgaggggtgta
taagttatacagtccctactgacgggggtaaacaacagaaaaatttcatcacactaggaa
atgtatctcggttaatagttgcagcttctaagcaaagtaagaatccagaaatacaacaaa
aggcaaaagtatatgaaaagtggatttttgatgaggttataccatctgttcataaacaag
gtggctacatcgctactactgatgatgatgatgatgaaacgattatggcaaaagctttga
tattagctcagaaaacgattaaaaaaaagcaatatgaaatacttgaacaacaacggatta
ttgaagtgcaaagacctaaagttgtatacgcagatgcagttgaagtatctgaggatacag
tacttgtaaaagatttagcaacagttttaagacaaaaaggtgttaatattggtgaggtta
gattgtttaaatggttgcgtgaaaatggctacctttgcaaacaaaaaggtgagatgtgga
atatgcctactcaacgtagtttagaattaggtgtgattgttgtgaagcatgggcttcgaa
caggaagcaatggtgaaatgaagaaaactcgtactccgaaaattactggtaagggacaag
tttactttataaataaaattttagaagaacaagggttattggcaatgtaaatgagaggag
caacattttgcgaaatgttaatgaaaaataaaaaaccacatatcaagttgcagcttgaaa
tgcggtaataaccgagtgacatccacccataaataactattgaatattgtatcataatat
tataatgataccaagtggatgtcctcaaattaggaggagcatatgaatgaaacaaaagaa
aaaccacgttctttaacatcttttacatcaatgtttgaagaaattagaaacactcaaggt
atcgatctattaagatacgactctttagatgaattcttaatagcgttcctcacgtaccga
acatcaatttaatacagtacatatacctagcgaattagtatatgtaaaccaagtatacga
gaaaatgaaaatggctcaaacttagcaaatcacttagggatttagatacctaataattgc
tttttctttgcatcaaattcttcttgagttagaatacctacatctaaaagttcttttaat
ttgattaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|388400.4.peg.3190 Bacillus sp. B14905 FIG   Antirepressor [Bacteriophage A118]


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33443 980.100;135-266
CDD::43300 966.100;126-266
isoelectric_point 8.97
molecular_weight 30460
PFAM::PF03374 942.550;125-266
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search