The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1005469.3.peg.4162: Escherichia coli 10.0821

This feature in The SEED Viewer

NCBI Taxonomy Id: 1005469

Current Assignment: Leucine-specific ABC transporter, substrate-binding protein LivK
Translate Function Assignments



Context on contig AMTO01000091 from base 118616 to 131278 (12663 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4155 119932 118616 1317 -         dlit(3062310)
dlit(8407831)
Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), substrate-binding protein UgpB locus|EC100821_4104, protein_id|EKK83637.1, gi|408610263
4156 121038 120292 747 - 359         Putative membrane protein locus|EC100821_4106, protein_id|EKK83639.1, gi|408610265
4157 121055 121168 114 + 16         FIG00640688: hypothetical protein locus|EC100821_4107, protein_id|EKK83640.1, gi|408610266
4158 121870 121157 714 - -12     1: 1   Branched-chain amino acid ABC transporter, ATP-binding protein LivF gene_name|livF, locus|EC100821_4108, protein_id|EKK83641.1, gi|408610267
4159 122639 121872 768 - 1     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, ATP-binding protein LivG locus|EC100821_4109, protein_id|EKK83642.1, gi|408610268
4160 123913 122636 1278 - -4     1: 1   Branched-chain amino acid ABC transporter, permease protein LivM locus|EC100821_4110, protein_id|EKK83643.1, gi|408610269
4161 124836 123910 927 - -4     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, permease protein LivH gene_name|livH, locus|EC100821_4111, protein_id|EKK83644.1, gi|408610270
4162 125993 124884 1110 - 47     1: 1   Leucine-specific ABC transporter, substrate-binding protein LivK gene_name|livK, locus|EC100821_4112, protein_id|EKK83645.1, gi|408610271
4163 126282 126145 138 - 151         FIG00638710: hypothetical protein locus|EC100821_4113, protein_id|EKK83646.1, gi|408610272
4164 126417 126800 384 + 134         Acetyl-CoA sensor PanM, required for maturation of L-aspartate decarboxylase locus|EC100821_4114, protein_id|EKK83647.1, gi|408610273
4165 127324 126797 528 - -4         FIG001353: Acetyltransferase locus|EC100821_4115, protein_id|EKK83648.1, gi|408610274
4166 127597 127331 267 - 6         hypothetical protein locus|EC100821_4116, protein_id|EKK83649.1, gi|408610275
4167 128850 127747 1104 - 149     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, substrate-binding protein LivJ gene_name|livJ, locus|EC100821_4117, protein_id|EKK83650.1, gi|408610276
4168 129975 129121 855 - 270       dlit(2841288)
dlit(6380765)
RNA polymerase sigma factor RpoH gene_name|rpoH, locus|EC100821_4118, protein_id|EKK83651.1, gi|408610277
4169 131278 130220 1059 - 244         Cell-division-associated, ABC-transporter-like signaling protein FtsX locus|EC100821_4119, protein_id|EKK83652.1, gi|408610278

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)


  Protein Sequence

>fig|1005469.3.peg.4162 Leucine-specific ABC transporter, substrate-binding protein LivK
MKRNAKTIIAGMIALAISHTALADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG
GIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMI
SPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARS
VQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVG
LKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYV
WITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWH
ADGSSTAAK

MD5 = 4b10bf51cece0bae5e5b50fe4da7ee3c


  DNA Sequence

>fig|1005469.3.peg.4162 Leucine-specific ABC transporter, substrate-binding protein LivK
atgaaacggaatgcgaaaactatcatcgcagggatgattgcactggcaatttcacacacc
gctttagccgacgatattaaagttgccgttgtcggcgcgatgtccggcccgattgcccag
tggggcgatatggaatttaacggcgcgcgtcaggcgattaaagacattaatgccaaaggg
ggaattaaaggcgataagctggttggcgtagaatatgacgacgcctgcgacccgaaacaa
gccgttgcggtcgccaacaaaatcgttaatgacggcattaaatacgttattggtcatctg
tgttcttcttctacccagcctgcgtcagatatctatgaagacgaaggtattcttatgatc
tcgccgggagcgacaaacccggagctgacccaacgcggttatcaacacattatgcgtact
gccgggctggactcttcccaggggccaacggcggcaaaatacattcttgagacggtgaag
ccccagcgcatcgccatcattcacgacaaacaacagtatggcgaagggctggcgcgttcg
gtgcaggacgggctgaaagcggctaacgccaacgtcgtcttcttcgacggtattaccgcc
ggggagaaagatttctccgcgctgatcgcccgcctgaaaaaagaaaacatcgacttcgtt
tactacggcggttactacccggaaatggggcagatgctgcgccaggcccgttccgttggc
ctgaaaacccagtttatggggccggaaggtgtgggtaatgcgtcgttgtcgaacattgcc
ggtgatgccgccgaaggcatgttggtcactatgccaaaacgctatgaccaggatccggca
aaccagggcatcgttgatgcgctgaaagcagacaagaaagatccgtccgggccttatgtc
tggatcacctacgcggcggtgcaatctctggcaactgcccttgaacgtaccggcagcgat
gagccgctggcgctggtgaaagatttaaaagctaacggtgcaaacaccgtgattgggccg
ctgaactgggatgaaaaaggcgatcttaagggatttgattttggtgtcttccagtggcac
gccgacggttcatccacggcagccaagtga


  DNA with Flanking Sequence

>fig|1005469.3.peg.4162 Leucine-specific ABC transporter, substrate-binding protein LivK
tactccggccagatcttttgcaggtcaatccggtcctggtcgctaaatttttctaatcga
atgatggtcagcttcatgggtaacccgtgtaaatcacaaaagtggaaccagtgtagcgaa
ataatttaatcggaggctttctcttttttatttcttttggcaggtgattaatttcttaac
agcaataattacaaagttaaaacattagagaatgaaaaatacccagcataatcccctgaa
tggtagtgaattattccgccctttgtgccgttattttatgctgacaaaggcacttttttc
tgtttatctatcaataaattcagaatattatctgttcttaatcgactgaaaaatagggac
tttaatcgctattatcacaaaatactgcgctaaacccttaatcagacaggcaaaaacagt
gcagtataaaaaaagaacagtctgatttgttaacacataaaaacaaagcaacacaacatc
acgaatggggatttttgactatgaaacggaatgcgaaaactatcatcgcagggatgattg
cactggcaatttcacacaccgctttagccgacgatattaaagttgccgttgtcggcgcga
tgtccggcccgattgcccagtggggcgatatggaatttaacggcgcgcgtcaggcgatta
aagacattaatgccaaagggggaattaaaggcgataagctggttggcgtagaatatgacg
acgcctgcgacccgaaacaagccgttgcggtcgccaacaaaatcgttaatgacggcatta
aatacgttattggtcatctgtgttcttcttctacccagcctgcgtcagatatctatgaag
acgaaggtattcttatgatctcgccgggagcgacaaacccggagctgacccaacgcggtt
atcaacacattatgcgtactgccgggctggactcttcccaggggccaacggcggcaaaat
acattcttgagacggtgaagccccagcgcatcgccatcattcacgacaaacaacagtatg
gcgaagggctggcgcgttcggtgcaggacgggctgaaagcggctaacgccaacgtcgtct
tcttcgacggtattaccgccggggagaaagatttctccgcgctgatcgcccgcctgaaaa
aagaaaacatcgacttcgtttactacggcggttactacccggaaatggggcagatgctgc
gccaggcccgttccgttggcctgaaaacccagtttatggggccggaaggtgtgggtaatg
cgtcgttgtcgaacattgccggtgatgccgccgaaggcatgttggtcactatgccaaaac
gctatgaccaggatccggcaaaccagggcatcgttgatgcgctgaaagcagacaagaaag
atccgtccgggccttatgtctggatcacctacgcggcggtgcaatctctggcaactgccc
ttgaacgtaccggcagcgatgagccgctggcgctggtgaaagatttaaaagctaacggtg
caaacaccgtgattgggccgctgaactgggatgaaaaaggcgatcttaagggatttgatt
ttggtgtcttccagtggcacgccgacggttcatccacggcagccaagtgaaaatcccacc
gcccgtgaaatgcgggcgggtttagaaaggttaccttatgtctgagcagtttttgtattt
cttgcagcagatgtttaacggcgtcacgctgggcagtacttacgcgctgattgccatcgg
ctacaccatggtttacggcattatcggcatgatcaacttcgcccacggcgaggtttacat
gatcggcagctacgtctcatttatgatcatcgccgcactgatgatgatgggcattgatac
cggctggctgctggtagcggcgggattcgtcggcgcaatcgtcattgccagcgcctacgg
ctggagtatcgaacgggtggcttaccgcccggtgcgtaactctaagcgcctgattgcact
catctcggcaatcggtatgtccatcttcctgcaaaactacgtcagcctgactgaaggttc
gcgcgacgtggcgctgcccagcttgtttaatggtcagtgggtagtgggtcatagcgaaaa
cttctctgcc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search