The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1005469.3.peg.4156: Escherichia coli 10.0821

This feature in The SEED Viewer

NCBI Taxonomy Id: 1005469

Current Assignment: Putative membrane protein
Translate Function Assignments



Context on contig AMTO01000091 from base 114977 to 125993 (11017 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4151 115720 114977 744 -           Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) gene_name|ugpQ, locus|EC100821_4100, protein_id|EKK83633.1, gi|408610259
4152 116787 115717 1071 - -4         Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), ATP-binding protein UgpC gene_name|ugpC, locus|EC100821_4101, protein_id|EKK83634.1, gi|408610260
4153 117634 116789 846 - 1         Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpE locus|EC100821_4102, protein_id|EKK83635.1, gi|408610261
4154 118518 117631 888 - -4         Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpA locus|EC100821_4103, protein_id|EKK83636.1, gi|408610262
4155 119932 118616 1317 - 97       dlit(3062310)
dlit(8407831)
Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), substrate-binding protein UgpB locus|EC100821_4104, protein_id|EKK83637.1, gi|408610263
4156 121038 120292 747 - 359         Putative membrane protein locus|EC100821_4106, protein_id|EKK83639.1, gi|408610265
4157 121055 121168 114 + 16         FIG00640688: hypothetical protein locus|EC100821_4107, protein_id|EKK83640.1, gi|408610266
4158 121870 121157 714 - -12     1: 1   Branched-chain amino acid ABC transporter, ATP-binding protein LivF gene_name|livF, locus|EC100821_4108, protein_id|EKK83641.1, gi|408610267
4159 122639 121872 768 - 1     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, ATP-binding protein LivG locus|EC100821_4109, protein_id|EKK83642.1, gi|408610268
4160 123913 122636 1278 - -4     1: 1   Branched-chain amino acid ABC transporter, permease protein LivM locus|EC100821_4110, protein_id|EKK83643.1, gi|408610269
4161 124836 123910 927 - -4     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, permease protein LivH gene_name|livH, locus|EC100821_4111, protein_id|EKK83644.1, gi|408610270
4162 125993 124884 1110 - 47     1: 1   Leucine-specific ABC transporter, substrate-binding protein LivK gene_name|livK, locus|EC100821_4112, protein_id|EKK83645.1, gi|408610271

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1005469.3.peg.4156 Putative membrane protein
MHYAVVVMLELLCCIHAYRTGQERYWIFIIFCFPVIGCVAYFVIVMLPETGADRHGHTLL
MRLQDKLNPERHLRKLTEELAIAETNQNHYALANELARLGRYHEAVPHYQQALSGIFAHE
AAMMLSLAQAQFAIQEFAACQQTLEDVMRYNPDFQSADGHLLFARTLAAQEKYADAESEF
EVLISYYPGPQARIYYAEMLAKMSRLREANEQYVAVVDTAKRSRPHYRKHHREWIKTANE
RLKQSVVQ

MD5 = 239ce4cf90385256178ff199b9766285


  DNA Sequence

>fig|1005469.3.peg.4156 Putative membrane protein
atgcattatgccgttgttgtcatgcttgaactgctttgctgtattcacgcttaccgtacc
ggacaagagcggtactggatttttatcattttctgttttccggtgattggctgcgtggcg
tatttcgtcatagtgatgctgcctgaaacgggcgctgaccgtcacgggcatactttgctg
atgcgcctgcaggacaaactcaaccctgagcgccacctgcgcaaattaaccgaagaactg
gcgattgccgagacgaatcaaaaccattatgcgttggctaatgaactggcgcgtctgggg
cgttatcacgaagctgttccccattatcagcaggcgttaagcgggatattcgcccatgaa
gcggcaatgatgctaagcctggcgcaggcacagtttgctattcaggagttcgccgcctgt
cagcagacgctggaagatgtgatgcgttataaccctgattttcagtcggcagacgggcat
ttgttatttgccagaacgttagccgcacaagaaaaatacgctgatgcggaaagcgagttt
gaagtattgatttcttattaccccggcccgcaggcgcgtatttactatgcggaaatgttg
gcgaaaatgagtcggttacgtgaagccaacgagcagtatgttgccgtggttgatacggct
aaacgctcaagacctcattatagaaaacaccaccgggaatggattaagaccgccaatgag
cggctgaagcagagtgtggtgcaatga


  DNA with Flanking Sequence

>fig|1005469.3.peg.4156 Putative membrane protein
tcagtttcaggagcgcataaagtgggtgtatgagctgtttccacgtcttcatgagcgtcg
tgttcagcgggcaggcaccatgtccggcggtgaacagcagatgctggcgattggtcgcgc
gctgatgagcaatccgcgtttgttgttgcttgatgagccatcgctcggtcttgcgccgat
tatcatccagcaaattttcgacaccatcgagcagctgcgcgagcaggggatgactatctt
cctcgtcgagcagaacgccaaccaggcgctgaagctcgctgatcgcggctacgtgctgga
aaacggccatgttgtgctctccgatactggtgatgcgctgctggcgaacgaagcagtgag
aagtgcgtatttaggcgggtaaattatcgataacccggcagctaagttctgccgggttat
tcgtccgtatacagacttgtttcaactgaccgggaggattaaaaccagaccacttatttg
ccacggaaaggttccctcccatgcattatgccgttgttgtcatgcttgaactgctttgct
gtattcacgcttaccgtaccggacaagagcggtactggatttttatcattttctgttttc
cggtgattggctgcgtggcgtatttcgtcatagtgatgctgcctgaaacgggcgctgacc
gtcacgggcatactttgctgatgcgcctgcaggacaaactcaaccctgagcgccacctgc
gcaaattaaccgaagaactggcgattgccgagacgaatcaaaaccattatgcgttggcta
atgaactggcgcgtctggggcgttatcacgaagctgttccccattatcagcaggcgttaa
gcgggatattcgcccatgaagcggcaatgatgctaagcctggcgcaggcacagtttgcta
ttcaggagttcgccgcctgtcagcagacgctggaagatgtgatgcgttataaccctgatt
ttcagtcggcagacgggcatttgttatttgccagaacgttagccgcacaagaaaaatacg
ctgatgcggaaagcgagtttgaagtattgatttcttattaccccggcccgcaggcgcgta
tttactatgcggaaatgttggcgaaaatgagtcggttacgtgaagccaacgagcagtatg
ttgccgtggttgatacggctaaacgctcaagacctcattatagaaaacaccaccgggaat
ggattaagaccgccaatgagcggctgaagcagagtgtggtgcaatgaaaatcttctttgc
cgttagaccagtgtcgcggcaatcttttgttaaaattgaaaaatgtagctctcatcgggc
agcaaaattggacgcagaatttgctgccatttttgctcttcatggtaaggagttctggcg
attagctggccgttaatcgcctcttttcagtgcattctcgggatatccgtgccccatctc
ccattttccctcacccgtaccgtcaccgccttgtcatctttctgacaccttactatctta
caaatgtaacaaaaaagttatttttctgtaattcgagcatgtcatgttaccccgcgagca
taaaacgcgtgaattcgcgcattcggtacaacaagagagataaacgatgaaaccgttaca
ttatacagcttcagcactggcgctcggactggcgttaatggggaatgcacaggcagtgac
gaccattccgttctggcattctatggaaggggaactgggtaaagaggtggattctctggc
ccaacgt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search