Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|979215.3.peg.2189 FIG01108236: hypothetical protein [Staphylococcus epidermidis NIHLM018]
MEKSVKLAVGIYLAIILIICSIYLAFILIGSLSGKDMSNSVLDTDHSRINNTSRNSNEDV
TSSNNESNNTKAHSFSNSEYKAVNINEAYKNNKHIKKANSSYQYY