Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|979211.3.peg.2267 Hypothetical protein SAV2327 [Staphylococcus epidermidis NIHLM023]
MKAYLYKFMPLLILVIGLIILYVINDYPTLLHVIVIIVFITSGLKNVYFVNNNIRNHIIW
MSPKLDRILGMLSGILYSGIYWVSFIKQQPLWIVILILVLTVGTAVLLETKLHITSLQLE
ERLSSERIKRKVISRHKAQRLKNIFFTVIVVVIISMLISLYLKLMVIFGIALAIFILASI
SVAIFEKYFTIYWKYVNYY