Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|931445.3.peg.2467 Cysteine desulfurase (EC 2.8.1.7) [Staphylococcus aureus subsp. aureus CIG1176]
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQADQLLQQAKVQ
INDMVNTNMTYDVVFTSGATESNNIALKGVAYRKFDTAREIITSVLEHPSVLEVVRYLEE
REGFKVKYVDVTKDGTIDLQHFNDLMSDKVGLVTCMYVNNVTGQIQPIPQMAEVIKNYPK
AHFHVDAVQAFGKISMDFNNVDSISLSGHKFNGLKGQGVLLVNHIQNIEPIIQGGGQEYG
VRSGTVNLPNDIAMVKAMKMANENLEALNAFVTELNNDVRQFLSQYQGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK