Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|931444.3.peg.2213 Cysteine desulfurase (EC 2.8.1.7) [Staphylococcus aureus subsp. aureus CIG1150]
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKAQ
INAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEA
HEGFKVKYVDVKKDGSINLEHFKELVSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
AHFHVDAVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYG
VRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK