Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93062.19.peg.883 Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI [Staphylococcus aureus subsp. aureus COL]
MKLLKTKNCLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIESMYHMSASTTTCDEI
MGVVSVSYPIEKLVIKIIETKAGLQNYKNRSINNMALLKKVLNHYTEKEQKQVVKYMRSN
GRYKPYNVIERLQVDLYQASIKQRSERQKQRNTAIENSKIARVNAYHQSSYVKVV