Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93062.19.peg.2666 Tetracycline resistence protein, metal-tetracycline/H+ antiporter [Staphylococcus aureus subsp. aureus COL]
MFSLYKKFKGLFYSVLFWLCILSFFSVLNEMVLNVSLPDIANHFNTTPGITNWVNTAYML
TFSIGTAVYGKLSDYINIKKLLIIGISLSCLGSLIAFIGHNHFFILIFGRLVQGVGSAAF
PSLIMVVVARNITRKKQGKAFGFIGSIVALGEGLGPSIGGIIAHYIHWSYLLILPMITIV
TIPFLIKVMVPGKSTKNTLDIVGIVLMSISIICFMLFTTNYNWTFLILFTIFFVIFIKHI
SRVSNPFINPKLGKNIPFMLGLFSGGLIFSIVAGFISMVPYMMKTIYHVNVATIGNSVIF
PGTMSVIVFGYFGGFLVDRKGSLFVFILGSLSISISFLTIAFFVEFSMWLTTFMFIFVMG
GLSFTKTVISKIVSSSLSEEEVASGMSLLNFTSFLSEGTGIAIVGGLLSLQLINRKLVLE
FINYSSGVYSNILVAMAILIILCCLLTIIVFKRSEKQFE