Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93062.19.peg.2511 Glycosyl-4,4'-diaponeurosporenoate acyltransferase precursor (EC 2.3.1.-) [Staphylococcus aureus subsp. aureus COL]
MKTMKKYIKTAFFCSMYWLIVQLNIANLGTRIPDKYFRQKYIIFKSFNFEKHGKFWNKWF
YVRKWKHKILDGHQLNQNIYDQRHLMTINTDEIEKMIIETKRAELIHWISILPVIIFNKG
PRLVKYINIFYAMIANVPIIIVQRYNRPRLTQLLRILKRRGERHD