Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93062.19.peg.2203 Molybdenum cofactor guanylyltransferase (EC 2.7.7.77) [Staphylococcus aureus subsp. aureus COL]
MKAIILAGGHSVRFGKPKAFAEVNGETFYSRVIKTLESTNMFNEIIISTNAQLATQFKYP
NVVIDDENHNDKGPLAGIYTIMKQHPEEELFFVVSVDTPMITGKAVSTLYQFLVSHLIEN
HLDVAAFKEDGRFIPTIAFYSPNALGAITKALHSDNYSFKNVYHELSTDYLDVRDVDAPS
YWYKNINYQHDLDALIQKL