Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93062.19.peg.2133 NAD-dependent protein deacetylase of SIR2 family [Staphylococcus aureus subsp. aureus COL]
MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLSRDY
LEDDPEGFINFCHKRLLFVDTMPNIVHDWIAKLERNQQSLGIITQNIDGLHSDAGSQHVD
ELHGTLNRFYCNVCHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRALNK
IEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVVKSL
MTE