Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93062.19.peg.2064 CTP synthase (EC 6.3.4.2) [Staphylococcus aureus subsp. aureus COL]
MTKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFIDINLNKFSNVTAGKVYSHVLKKERRGDYLGGTVQVIPHITN
EIKERLLLAGESTNADVVITEIGGTTGDIESLPFIEAIRQIRSDLGRENVMYVHCTLLPY
IKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYEMTQDLKDKIALFCDINKESVIECR
DADSLYEIPLQLSQQNMDDIVIKRLQLNAKYETQLDEWKQLLDIVNNLDGKITIGLVGKY
VSLQDAYLSVVESLKHAGYPFAKDIDIRWIDSSEVTDENAAEYLADVDGILVPGGFGFRA
SEGKISAIKYARENNVPFFGICLGMQLATVEFSRNVLGLEGAHSAELDPATPYPIIDLLP
EQKDIEDLGGTLRLGLYPCSIKEGTLAQDVYGKAEIEERHRHRYEFNNDYREQLEANGMV
ISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEASLKYQQNK