Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93062.19.peg.1636 FIG01108208: hypothetical protein [Staphylococcus aureus subsp. aureus COL]
MSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK