Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93062.19.peg.1321 Aspartokinase (EC 2.7.2.4) [Staphylococcus aureus subsp. aureus COL]
MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLYEKVI
NHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALLSCGE
DFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEKLIIP
GFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPELIEE
ITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAKNVIS
GISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSKQIQN
KETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLKMINQ
GASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN