Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93061.5.peg.852 Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1) [Staphylococcus aureus subsp. aureus NCTC 8325]
MIKLILKRLGLMIPLLILISIVVFSLAIIQPGDPFSDLQNGKIKQEAINAQREKLGLNDS
IPHQYIRWVNHVIHGDLGESIKYKRPVIDVIEERIPNTILLGAMSLIITYIISFALGITS
GRYSYSLTDYTVQIFNYLMLAIPSFIAGVFAIFIFSFELQWFPFQGSVDINLKEGTFEYY
MSKIYHTFLPAFTLGLLSTAGYIQYLRNDIIENSKKDYVLTARSKGLSMNKIYNKHILRN
SLIPIITFLGADIVSILGGAVITETIFSYNGIGKLFLESVIGQDYPLMMALTLFFSFLGL
LGNLISDITYGFIDPRIRSN