Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93061.5.peg.79 Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase; teichuronic acid biosynthesis glycosyltransferase TuaA [Staphylococcus aureus subsp. aureus NCTC 8325]
MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDKLEEVRKSYYPIKRAIDLILSIVLLFLT
LPIMVIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKNAEKNGAQWADKDDDRI
TNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFSSEVIGFEQRCLVTPGLT
GLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMVVITGEGSR