Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93061.5.peg.1895 Phage integrase [Staphylococcus aureus subsp. aureus NCTC 8325]
MPVYKDDNTGKWYFSIRYKDVYGNNKRKMKRGFERKKDAKLAESEFIQNVKYGYSDNQPF
EYIFFDRLKNENLSARSIEKRTTEYNTHIKERFGNIPIGKITTTQCTAFRNYLLNDAGLS
VDYARSVWAGFKAVINYAKKHYKLLYDPTLSVTPIPRTKPQAKFITREEFDEKVEQITND
TSRQLTRLLFYSGLRIGEALALQWKDYDKIKGEIDVNKKINLSNRKIEYNLKKESSKGII
PVPNLIREMLKNMYNESSKRYKYFDENYFIFGGLEPIRYVTYSYHFKSVFPNLKIHHLRH
SYASYLINNGVDMYLLMELMRHSNITETIQTYSHLYTDKKHQAMSIFD