Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93061.5.peg.1669 Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) [Staphylococcus aureus subsp. aureus NCTC 8325]
MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDET
IDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKS
PNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLCSKRNYWYKK
PNFSRIAQIASYVNPNYALVTRKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITD
NPKLFIK