Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93061.5.peg.1489 Late competence protein ComGF, access of DNA to ComEA, FIG017774 [Staphylococcus aureus subsp. aureus NCTC 8325]
MLVAMMVISITLLIVPDLIRLSKTFLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQ
HRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGT
NVQTKTIYV