Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93061.5.peg.1413 Phage deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) [Staphylococcus aureus subsp. aureus NCTC 8325]
MTNTLQVKLLSKNARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGL
LTSRSGVSSKTYLVIETGKIDAGYHGNLGINIKNDEERDGIPFLYDDIDAELEDGLISIL
DIKGNYVQDGRGIRRVYQINKGDKLAQLVIVPIWTPELKQVEEFESVSERGAKGFGSSGV