Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|93061.5.peg.1331 Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1 [Staphylococcus aureus subsp. aureus NCTC 8325]
MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENH
KLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK