Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|904744.3.peg.1557 Cysteine desulfurase (EC 2.8.1.7) [Staphylococcus aureus subsp. aureus 21259]
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKAQ
INAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEA
HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
AHFHVDAVQAFGKISMDLNNVDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYG
VRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK