Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|869686.4.peg.2933 Dihydroxy-acid dehydratase (EC 4.2.1.9) [Escherichia coli 9.0111]
MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLV
AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADPKVSDSQ
SDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIV
ELTKRYYEQNDESALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEIDFTMSD
IDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELDRAGLLNRDVKNVLGLTLPQT
LEQYDVMLTQDDAVKNMFRAGPAGIRTTQAFSQDCRWDSLDDDRANGCIRSLEHAYSKDG
GLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVAGDVVVIRY
EGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASGGSIGL
IEDGDLIAIDIPNRGIQLQVSDAELAARREAQEARGDKAWTPKNRERQVSFALRAYASLA
TSADKGAVRDKSKLGG