Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|702450.3.peg.1808 Cysteine synthase (EC 2.5.1.47) [Turicibacter sp. PC909]
MEKMVHSLIELIGHTPLLELCQYNQQEGVLASIVAKLEYFNPAGSVKDRVAYSMVLAAEE
EGRLSKDSVIIEPTSGNTGIGLAFVCAARGYQLTLVMPETMSLERRHLLKALGANLVLTK
GSDGMKGAIAKANELCASTPRGIILQQFENSANPRIHKQTTALEIWDDLEGNVDVFVAGV
GTGGTITGIGEVLKQKNPDIKIIAVEPKSSPVLSGGKPGPHKIQGIGAGFVPKILNESII
DDIVQVSDEDAIATSRKLAKSEGLLVGISSGAAIFAATELAKQEAFAFKRIVVLCPDTGE
RYLSTGLYEL