Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|666475.3.peg.278 Tryptophan synthase beta chain (EC 4.2.1.20) [Pseudomonas syringae pv. aesculi str. 2250]
MTQTNFRSGPDANGLFGSFGGRYVAETLMPLVLDLNREYEAAKADPEFAKEMAYFQRDYV
GRPNPLYFAERLTEFCGGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKEQMQEKEGRLPDSLIACVG
GGSNAMGLFHPFLDDASVEIIGVEAGGHGVDTDKHAASLNGGVPGVLHGNRTYLLQDGDG
QITDAHSISAGLDYPGIGPEHAFLHEVKRVEYVSITDDEALDAFHQCCLLEGIIPALETA
HALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMAAAEKTQEKLV