Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|665950.3.peg.211 Cysteine synthase (EC 2.5.1.47) [Lachnospiraceae bacterium 3_1_46FAA]
MSKIYTSADQLIGKTPLMELTHIEKEHGLKAKILAKLEYFNPAGSVKDRVAKAMIDEAEK
SGKLKKDSVIIEPTSGNTGIGLAAVAAARGYRIIIVMPETMSVERRQIMKAYGAELVLSD
GARGMKGAIEKAEELAKELPNSFIPGQFVNPANPQAHRDTTGPEIYEDTDAKVDIFVAGV
GTGGTLTGVGEYLKSKKKDVEIVAVEPKSSAVLSEGIPGAHKIQGIGAGFVPEILNTNVY
DEIIAVSDEDAFATGKMIGQREGILVGISSGAAVWAAIELAKRSENEGKTIVVLLPDTGD
RYLSTPMFAD