Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|665950.3.peg.1959 Threonine dehydratase (EC 4.3.1.19) [Lachnospiraceae bacterium 3_1_46FAA]
MMTLEKFEEASELVKKVTNSTKLVYSDYLSEQSGGKVYLKPENMQHTGAYKIRGAYYKIS
TLSDEERGRGLITASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYGAEVILH
GDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTIAMEIVQELPTVDYILVPIGGGG
LVSGVATLAKMLNPKIKVIGVEPAEAASMKAALAAGEVVQLESANTIADGTAVKAVGDKI
LPFVKENVDDVLLVEDDELIGAFLDMVENHKMIVENSGLLSVAALKQLDCKGKKVVCVLS
GGNMDVITMSSIVQHGLIQRDRIFSVSVLLPDKPGELVQVAQTIAEAQGNVIKLEHNQFV
STNRNAAVELRITMEAFGTEHKQEILKALEKKGYRPRLIGAKLY