Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|658659.3.peg.1421 Cysteine desulfurase (EC 2.8.1.7) [Erysipelotrichaceae bacterium 3_1_53]
MIYLDYASTTPIRPEILKTYYKLLQDYYGNSDSLHDLGRESGKLMEQSRAQIAQLLHVYR
EEILFTSCASESNNAAIKGAAWQYAGRGKHLITTCVEHSSIHNAMEQLKEYFGYEVTYLP
VNASGSVDVEALKQALRKDTILVSMMLVNNETGAINPIRACADYVHANSRALFHVDGVQA
LGKVEVDLSCVDLATFSAHKIYGLKGSAILYKKKHVELVPLISGGQQENGMRAGTSNAPV
NIVFAKTLRLALEQQKEAYAHVKALNAHLRKEVSVMEDIVINSPQDGSPFILNISNLRIG
SEIMLNALNAKGFAVSAQSTCSSHSKAVSAVLLAMGLGEQRATHAIRISLSHLTTRQEVD
AFLQALKEINHDYRTK