Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|649764.3.peg.1527 Cysteine synthase (EC 2.5.1.47) [Slackia exigua ATCC 700122]
MTVYTSIDQLIGNTPLLELKGIEAKEGLKARVLGKLEYFNPAGSVKDRIAKAMLDDAEAR
GKIGPGATIIEPTSGNTGVGLASVAAARGYKVVITMPETMSVERRLLMKAYGAQLVLTDG
SKGMKGAIAKAQELADQMPNSFLAGQFVNPANPAVHKATTGPEIWADTDGTVDIFVAGVG
TGGTVTGTGAYLKEQNSAVKVVAVEPASSPVLSEGTSGSHKIQGIGAGFVPDVLDTSVYD
EVVKVENDDAFETGREIGRLEGVLVGISSGAAVWAAVELAKRPENEGKTIVALLPDTGER
YLSTPLFAE