Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|575615.3.peg.1326 Cysteine synthase (EC 2.5.1.47) [Prevotella sp. oral taxon 317 str. F0108]
MAHIAKQLTELIGGTPLLELGKFSVSNNLQTPIVAKIESFNPGGSVKDRIALAMIEDAER
SGVLKPGATIIEPTSGNTGVGLALVAAVKGYQLILTMPETMSVERRNLVKAYGAQVKLTP
GKDGMKGAIEMAQQLREEIPGAVILQQFENLANPERHYETTAREIWADTSGQVDVFVAGV
GTGGTVSGVGKYLKEKNPNVRIVAVEPADSPVLSGGKPGPHKIQGIGAGFVPKTYNGNVV
DEVVQVSNDDAIRTGRQLAQQEGVLAGISSGAAAFAAAQLAKRPENAGKRIVTLLPDTGE
RYLSTVLYAFEEYPL