Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|573061.4.peg.499 Cysteine synthase (EC 2.5.1.47) [Clostridium cellulovorans 743B]
MSKVYKSITELIGKTPLVELKNYGKVKGIDASIIAKIEFFNPAGSVKDRIAKAMIEDAET
KGLLKEGSVIIEPTSGNTGIGLASVAAARGYRIILTMPDTMSIERRNLLKAYGAELVLTE
GAKGMKGAIEKAKELGEEIPNSFLPGQFVNPSNPKIHRETTGPEIWEDIDGKVDIFVAGI
GTGGTITGVGEFLKSKNPDVKIVAVEPAASPVLSKGTPGPHKIQGIGAGFVPDVLNKGIY
DEIITVENEDAFETGRAIAKIEGILVGISSGAALWAATELANRPENHGKNIVVLLPDTGE
RYFSTPLFAEN